MMASDGHPGPPSVTPGSPLSAGGREWQGMAGSCWNITYVQDSVGPATSTLMFVAGVVGNG LALGILGARRRSHPSAFAVLVTGLAVTDLLGTCFLSPAVFVAYARNSSLLGLAHGGTMLC DTFAFAMTFFGLASTLILFAMAVERCLALSHPYLYAQLDGPRCARFALPSIYAFCCLFCS LPLLGLGEHQQYCPGSWCFIRMRSAQPGGCAFSLAYASLMALLVTSIFFCNGSVTLSLYH MYRQQRRHHGSFVPTSRAREDEVYHLILLALMTVIMAVCSLPLMIRGFTQAIAPDSREMG DLLAFRFNAFNPILDPWVFILFRKAVFQRLKFWLCCLCARSVHGDLQAPLSRPASGRRDP PAPTSLQAKEGSWVPLSSWGTGQVAPLTAVPLTGGDGCSVGMPSKSEAIAAC
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Receptor for prostacyclin (prostaglandin I2 or PGI2). The activity of this receptor is mediated by G(s) proteins which activate adenylate cyclase.
Gene References into Functions
results provide evidence that PGI2/IP signaling suppresses the STAT6-independent pathway of allergic airway inflammationPMID:27456482
Data (including data from studies using transgenic mice, an murine experimental model of diabetes, and mouse/human cell lines) suggest prostaglandin I2 receptor (Ptgir) is involved in insulin secretion in pancreatic beta-cells and in permselectivity in glomerular podocytes; the mechanism appears to involve regulation of post-translational phosphorylation of nephrin.PMID:26868296
Deletion of the I prostanoid receptor had no effect on the attenuation of atherogenesis by mPGES-1 deletion in the low-density lipoprotein receptor knockout mice.PMID:27440004
Prostacyclin promotes the up-regulation of Nox4 in endothelial cells, which opens up a novel strategy that protects and enhances endothelial cell functions in cardiovascular disease, such as repair after myocardial infarction or other ischemic conditions.PMID:24450852
Its signaling increase cAMP concentration, which prototes sysnesis of HGF, causing angiogenesis.PMID:24292413
an essential role of the COX-2/PGI2 receptor axis in the cardioprotection afforded by the late ischemic preconditioningPMID:22844439
findings suggest the IP receptor might maintain an angiogenic switch in the "on" state in tumor endothelial cells (TEC); suggest that the IP receptor is a TEC-specific marker and might be a useful therapeutic targetPMID:22380928
PGI2-induced PPAR delta activation accelerates blastocyst hatching in micePMID:21511721
For the first time these results show that activation of prostaglandin I2 receptor can attenuate damage following cerebral ischemia.PMID:20621166
identify PGI(2)-prostaglandin I2 receptor as an important pathway for inhibiting allergic pulmonary inflammation by controlling recruitment of CD4(+) Th2 cells into the inflammatory sitePMID:17947695
The prostacyclin/IP pathway suppresses cardiac fibrosis, at least partly, by inducing CREB phosphorylation.PMID:20403362
Prostaglandin I2 receptor signaling promotes T helper cell type (Th)1 differentiation through a cyclic adenosine monophosphate (AMP)-protein kinase A pathway, thereby initiating acquired cutaneous immune responses.PMID:20400695
The prostaglandin I(2)-IP system is essential for EPCs to accomplish their function and plays a critical role in the regulation of vascular remodeling.PMID:20007911
Results identify the cyclooxygenase-2 gene as a target of APOE signaling, link HDL and APOE to prostacyclin receptor IP action, and describe a potential new basis for the cardioprotective effect of HDL and APOE.PMID:14966570
results suggest that signaling through IP has antiviral effects while protecting against respiratory syncytial virus-induced illnessPMID:15367596
The -CSLC motif of the IP is a direct target for inhibition by the FTI SCH66336, and in the presence of strong farnesyltransferase inhibition, the IP does not undergo compensatory geranylgeranylation.PMID:15469414
Baseline systolic blood pressurewas significantly lower in the IP(-/-) group than in the IP(+/+) mice.PMID:15635218
IP plays a suppressive role in the development of pressure overload-induced cardiac hypertrophy via the inhibition of both cardiomyocyte hypertrophy and cardiac fibrosisPMID:15983244
IP receptors play an important role in preimplantation embryo development and mediate the embryo's response to exogenous PGI(2)PMID:17905746
ONO-54918-07 mimics the effect of PGE1(prostaglandin E1), supporting the notion that the PGE1 effect on NG108-15 cells is mediated by prostacyclin receptors.PMID:17952410
prostacyclin receptor knockout mice showed normal pain behavior in all testsPMID:18938093
PGIS/ IP transgenic animals with lung-specific PPARgamma overexpression also developed fewer lung tumors.PMID:19138979