Home
Product
Protein
Transmembrane Proteins
Recombinant Mouse Probable G-protein coupled receptor 83 (Gpr83)

Recombinant Mouse Probable G-protein coupled receptor 83 (Gpr83)

Code: CSB-CF009835MO

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5532

Quantity:

Express system: in vitro E.coli expression system

Species: Mus musculus (Mouse)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Gpr83

Uniprot NO.

P30731

Alternative Names

Gpr83; Gir; Gpr72; Probable G-protein coupled receptor 83; Glucocorticoid-induced receptor

Species

Mus musculus (Mouse)

Source

in vitro E.coli expression system

Expression Region

18-423

Target Protein Sequence

TEQPQVVTEHPSMEAALTGPNASSHFWANYTFSDWQNFVGRRRYGAESQNPTVKALLIVA YSFTIVFSLFGNVLVCHVIFKNQRMHSATSLFIVNLAVADIMITLLNTPFTLVRFVNSTW VFGKGMCHVSRFAQYCSLHVSALTLTAIAVDRHQVIMHPLKPRISITKGVIYIAVIWVMA TFFSLPHAICQKLFTFKYSEDIVRSLCLPDFPEPADLFWKYLDLATFILLYLLPLFIISV AYARVAKKLWLCNTIGDVTTEQYLALRRKKKTTVKMLVLVVVLFALCWFPLNCYVLLLSS KAIHTNNALYFAFHWFAMSSTCYNPFIYCWLNENFRVELKALLSMCQRPPKPQEDRLPSP VPSFRVAWTEKSHGRRAPLPNHHLPSSQIQSGKTDLSSVEPVVAMS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Orphan receptor. Could be a neuropeptide Y receptor.

Gene References into Functions

this study identified a receptor for PEN in mouse hypothalamus and Neuro2A cellsit. It is GPR83. PMID:27117253
Data indicate that the extracellular portion of G-protein coupled receptor 83 (GPR83) has a strong regulatory function on this receptor. PMID:25516095
Gpr83 modulates ghrelin action and Gpr83 regulates systemic metabolism through other ghrelin-independent pathways. PMID:23744028
GIR -/- mice show increased preference for sucrose, delayed acquisition of spatial learning and insensitivity to the anxiogenic effects of restraint stress. PMID:23088626
GPR83 may participate in central thermoregulation and the central control of circulating adiponectin. PMID:22560055
Gpr83 is critically involved in the peripheral conversion of Foxp3-negative to Foxp3-expressing regulatory T cells in vivo. PMID:16785516
These results demonstrate that GPR83 is dispensable for Treg-cell development and function. PMID:17893329