Recombinant Mouse Probable C-C chemokine receptor type 3 (Ccr3)

Code: CSB-CF004842MO
Size:
20μg
20μg100μg
US$5181
Quantity:
Express system: in vitro E.coli expression system
Species: Mus musculus (Mouse)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
Ccr3
Uniprot NO.
Alternative Names
Ccr3; Cmkbr1l2; Cmkbr3; Probable C-C chemokine receptor type 3; C-C CKR-3; CC-CKR-3; CCR-3; CCR3; CKR3; Macrophage inflammatory protein 1-alpha receptor-like 2; MIP-1 alpha RL2; CD antigen CD193
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
1-359
Target Protein Sequence
MAFNTDEIKTVVESFETTPYEYEWAPPCEKVRIKELGSWLLPPLYSLVFIIGLLGNMMVV LILIKYRKLQIMTNIYLFNLAISDLLFLFTVPFWIHYVLWNEWGFGHYMCKMLSGFYYLA LYSEIFFIILLTIDRYLAIVHAVFALRARTVTFATITSIITWGLAGLAALPEFIFHESQD SFGEFSCSPRYPEGEEDSWKRFHALRMNIFGLALPLLIMVICYSGIIKTLLRCPNKKKHK AIRLIFVVMIVFFIFWTPYNLVLLFSAFHSTFLETSCQQSKHLDLAMQVTEVIAYTHCCI NPVIYAFVGERFRKHLRLFFHRNVAVYLGKYIPFLPGEKMERTSSVSPSTGEQEISVVF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Receptor for C-C type chemokine. Binds and responds to a variety of chemokines, including CCL11, CCL26, CCL7, CCL13, RANTES(CCL5) and CCL15. Subsequently transduces a signal by increasing the intracellular calcium ions level. In addition acts as a possible functional receptor for NARS1.
Gene References into Functions
  1. We found abnormalities in sleep patterns in the resting phase and in the number of Hcrt neurons in Ccr3 KO mice. These observations suggest a role for CCR3 in sleep-wake regulation in narcolepsy patients PMID:29186205
  2. Study found that CCR3 plays a crucial role in neuronal injury. CCR3 deletion or inhibition protects neurons from oxygen-glucose-deprivation-induced cytotoxicity in primary cortical cultures. CCR3 KO mice also displayed significant reduction of infarct volume in the brain after experimental stroke. PMID:27822494
  3. Retinal inhibition of CCR3 induces retinal cell death in a murine model of choroidal neovascularization. PMID:27309355
  4. Periprostatic adipocytes drive prostate cancer progression in obesity via CCL7 secretion which stimulates CCR3 expressing tumor cells. PMID:26756352
  5. The RNA interference therapy to CCR3 by local administration pernasal can suppress the process of the development, migration and invasion of the allergic rhinitis eosinophil. PMID:24507645
  6. Chemokine CCR3 ligands-binding peptides derived from a random phage-epitope library. PMID:23183094
  7. CCR3 plays no role in choroidal neovascularization development. PMID:22183343
  8. The collective data suggest that activation of the CB2R results in "cross-talk" with CCR-3, resulting in decreased migratory responsiveness to Tat. PMID:21735070
  9. CCR3 plays no significant role in choroidal neovascularization development. PMID:21358803
  10. The CCR3/eotaxin pathway is involved in the regulation of allergen-driven in situ haematopoiesis and the accumulation/mobilization of eosinophil-lineage-committed progenitor cells in the lung. PMID:20875077
  11. Trafficking to the cell surface of nascent CCR3 is critically dependent on a C-terminal leucine residue, suggestive of specific mechanisms for CCR3 export. PMID:20541248
  12. CCR3-deficiency does not alter mast cell phenotype or ability to migrate in vitro PMID:20050333
  13. CCR3 is essential for skin eosinophilia and airway hyperresponsiveness in a murine model of allergic skin inflammation. PMID:11877470
  14. 3-fold increased expression in IL-5 transgenic mice leads to increased responsiveness of eosinophils to eotaxin PMID:12083417
  15. role of CCR3 in the endogenous mechanisms involved in the inflammatory cell recruitment in an experimental model of allergic cutaneous reaction PMID:12118095
  16. CCR3 is constitutively expressed on CD34+ progenitor cells obtained from cord blood, and it behaves as a functional receptor as it transduces in vitro and in vivo chemotactic responses after binding to its ligand eotaxin. PMID:12496441
  17. Eosinophils survive longer under the influence of CCR3-reactive chemokines, which aid the infiltration of these cells into the tissue and that eosinophils may survive even longer if they encounter survival factors at local inflammatory sites. PMID:12673069
  18. Distinct acidic and basic residues within CCR3 determine both receptor expression and activation by the eotaxins. PMID:16102831
  19. The CCR3 pathway plays a fundamental role in eosinophil recruitment during ovalbumin-induced experimental asthma. PMID:16210640
  20. CCL11 and CCR3 are important in the pulmonary recruitment of granulocytes and play significant pathogenic roles in bleomycin-induced lung fibrosis. PMID:16314464
  21. YM-344031, a novel and selective small molecule CCR3 antagonist, potently inhibited ligand binding (IC(50)=3.0nM), ligand-induced Ca(2+) flux (IC(50)=5.4nM), and the chemotaxis of human CCR3-expressing cells (IC(50)=19.9nM). PMID:16343433
  22. eosinophils via CCR3 have a central role in chronic allergic airway disease PMID:17060636
  23. We report that in the absence of eotaxin-2 or CCR3, there was a profound reduction in IL-13-induced eosinophil recruitment into the lung lumen. IL-13 transgenic mice deficient in CCR3 had a 98% reduction in lung eosinophils. PMID:17148674
  24. agonists and antagonists of CCR3 appear to occupy overlapping sites within the transmembrane helical bundle, suggesting a fine line between agonism and antagonism of chemokine receptors PMID:17635911
  25. Heligmosomoides infection led to reduction in number of lung eosinophils with decreased levels of eotaxin in bronchoalveolar lavage fluid, lowered of CCR3 receptor expression on eosinophils and impaired chemotaxis of these cells toward eotaxin. PMID:17650182
  26. in knock-out mice, immediate hypersensitivity reactions in the conjunctiva are ablated despite normal numbers of tissue mast cells and levels of IgE PMID:19147836
  27. Genetic or pharmacological targeting of CCR3 or eotaxins inhibited injury-induced choroidal neovascularisation in mice PMID:19525930

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Detected in skeletal muscle and in trace amounts in leukocytes.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products