Home
Product
Protein
Transmembrane Proteins
Recombinant Mouse Pre T-cell antigen receptor alpha (Ptcra)

Recombinant Mouse Pre T-cell antigen receptor alpha (Ptcra)

Code: CSB-CF018961MO

Rate （N/A）
Review （0）

Size:

20μg100μg

US$3864

Quantity:

Express system: in vitro E.coli expression system

Species: Mus musculus (Mouse)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Ptcra

Uniprot NO.

P0C6B2

Alternative Names

Ptcra; Pre T-cell antigen receptor alpha; pT-alpha; pTa; gp33; pT-alpha-TCR

Species

Mus musculus (Mouse)

Source

in vitro E.coli expression system

Expression Region

17-199

Target Protein Sequence

LPSGIAGTPFPSLAPPITLLVDGRQHMLVVCLVLDAAPPGLDNPVWFSAGNGSALDAFTYGPSLAPDGTWTSLAQLSLPSEELEAWEPLVCHTRPGAGGQNRSTHPLQLSGESSTARSCFPEPLGGTQRQVLWLSLLRLLLFKLLLLDVLLTCSHLRLHVLAGQHLQPPPSRKSLPPTHRIWT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

The pre-T-cell receptor complex (composed of PTCRA, TCRB and the CD3 complex) regulates early T-cell development. Isoform 1 acts to retain most TCRB intracellularly, while isoform 2 permits higher levels of cell surface TCRB expression and facilitates signaling from the CD3-TCRB complex.

Gene References into Functions

pre-TCR expression is not essential for thymic differentiation to DP cells or for V-DJbeta suppression PMID:21673984
Combined expression of pTalpha and Notch3 in T cell leukemia identifies the requirement of preTCR for leukemogenesis PMID:11891328
The cytoplasmic tail of pTalpha plays a critical role in T lymphocyte development. PMID:11927911
pTalpha plays a role in protecting developing thymocytes from DNA damage in mice PMID:12114514
the dosage of E2A, HEB, and SCL determines pT alpha gene expression in immature T cells PMID:12566462
when in competition with pTalpha, TCRalpha induced defective proliferation, survival, and differentiation of alphabeta T lymphocyte precursors PMID:14993248
expression is up-regulated in regulatory T cells PMID:19461123

Hide All

Subcellular Location

Membrane; Single-pass type I membrane protein.

Tissue Specificity

Isoform 1 is expressed at higher levels than isoform 2 in the thymus while only isoform 2 is expressed in polyclonal beta-only cells. Isoform 1 shows a predominant expression in immature thymocytes.

Database Links

UNIGENE: Mm.215173

KEGG: mmu:19208

Promotions