GTIGVNEDDIVTPGTGDGMVPPGIEDKITTTGATGGLNESTGKAPLVPTQRERGTKPPLEELSTSATSDHDHREHESTTTVKVVTSHSVDKKTSHPNRDNAGDETQTTDKKDGLPVVTLVGIIVGVLLAIGFVGGIFIVVMKKISGRFSP
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Mediates effects on cell migration and adhesion through its different partners. During development plays a role in blood and lymphatic vessels separation by binding CLEC1B, triggering CLEC1B activation in platelets and leading to platelet activation and/or aggregation. Interaction with CD9, on the contrary, attenuates platelet aggregation and pulmonary metastasis induced by PDPN. Mediates effects on cell migration and adhesion through its different partners. Through MSN or EZR interaction promotes epithelial-mesenchymal transition (EMT) leading to ERZ phosphorylation and triggering RHOA activation leading to cell migration increase and invasiveness. Interaction with CD44 promotes directional cell migration in epithelial and tumor cells. In lymph nodes (LNs), controls fibroblastic reticular cells (FRCs) adhesion to the extracellular matrix (ECM) and contraction of the actomyosin by maintaining ERM proteins (EZR; MSN and RDX) and MYL9 activation through association with unknown transmembrane proteins. Engagement of CLEC1B by PDPN promotes FRCs relaxation by blocking lateral membrane interactions leading to reduction of ERM proteins (EZR; MSN and RDX) and MYL9 activation. Through binding with LGALS8 may participate in connection of the lymphatic endothelium to the surrounding extracellular matrix. In keratinocytes, induces changes in cell morphology showing an elongated shape, numerous membrane protrusions, major reorganization of the actin cytoskeleton, increased motility and decreased cell adhesion. Controls invadopodia stability and maturation leading to efficient degradation of the extracellular matrix (ECM) in tumor cells through modulation of RHOC activity in order to activate ROCK1/ROCK2 and LIMK1/LIMK2 and inactivation of CFL1. Required for normal lung cell proliferation and alveolus formation at birth. Does not function as a water channel or as a regulator of aquaporin-type water channels. Does not have any effect on folic acid or amino acid transport.
Gene References into Functions
mouse podoplanin initiates the formation of stable platelet aggregates at high shear. We speculate that this is important during the development of the mouse cerebrovasculature triggered by podoplanin on neuroepithelial cells and represents a specialized form of hemostasis.PMID:29090616
Results suggest podoplanin-CLEC-2 as a novel anti-inflammatory axis regulating immune cell recruitment and activation in sepsis.PMID:29269852
TGF-beta release from platelets is necessary for podoplanin-mediated tumor invasion and metastasis in lung cancer.PMID:28176852
study uncovers a role for Pdpn in mammary SC function and, importantly, identifies Pdpn as a new regulator of Wnt/beta-catenin signaling, a key pathway in mammary development and tumorigenesis.PMID:29361573
these data suggest that the platelet CLEC-2-podoplanin signaling axis regulates the severity of lung inflammation in mice and is a possible novel target for therapeutic intervention in patients at risk of developing ARDS.PMID:28839100
Describe a bone-specific conditional Pdpn hypomorphic knockout mouse and confirm a role for Pdpn in the attainment of fully elongated osteocyte dendrites.PMID:28488815
In podoplanin conditional knockout mice (Wnt1-Cre;PdpnDelta/Deltamice), the tooth and alveolar bone showed no morphological abnormalities and grow normally, indicating that podoplanin is not critical in the development of the tooth and bone.PMID:28222099
Podoplanin expressed by lymphatic vessels prevents postnatal blood filling of the lymphatic vascular system and contributes to efficient dendritic cell migration to the lymph nodes.PMID:27810998
Study provides evidence that podoplanin as a novel component of the neuronal machinery underlying neuritogenesis, synaptic plasticity, and hippocampus-dependent memory functions.PMID:27558977
This study suggests that ppGalNAc-T13 contributes to neuronal differentiation through glycosylating and stabilizing PDPN, which provides insights into the regulatory roles of O-glycosylation in mammalian neural development.PMID:27629416
A reciprocal interaction between CLEC-2 on megakaryocytes and PDPN on Bone marrow (BM) Fibroblastic reticular cell-like cells contributes to the periarteriolar megakaryopoietic microenvironment in mouse BM.PMID:26796360
Data indicate that a mechanism reliant upon blockade of proteasome-mediated E11 destabilization contributes to osteocytogenesis and that this may involve downstream targeting of RhoA.PMID:26639105
it is likely that PDPN, while being dispensable during re-epithelialization, has a crucial role in migration and invasion of transformed keratinocytes.PMID:26121181
Report distinct podoplanin-positive stromal cell populations and a novel progenitor subset in chronic liver inflammation and fibrosis.PMID:26564718
CLEC-2 is an adhesive receptor that supports platelet arrest to podoplanin under venous shear. Src/Syk-dependent signalling stabilises platelet adhesion to podoplanin.PMID:25694214
Alternative NF-kappaB signaling regulates mTEC differentiation from podoplanin-expressing presursors in the cortico-medullary junction.PMID:25973789
These results provide new insight into PDPN phosphorylation dynamics and the role of PDPN in cell motility.PMID:25959509
Podoplanin and CLEC-2 critically drive the formation and integrity of developing cerebral blood vessels.PMID:25908104
DC-derived LTBR ligands are critical mediators of lymph node cells survival, and LTBR signaling on reticular stromal cells is mediated by Pdpn expression.PMID:25902483
PDPN functions as an inhibitory molecule on T cells, thereby promoting tissue tolerance by limiting long-term survival and maintenance of CD4+ effector T cells in target organs.PMID:25415436
CLEC-2 signaling promotes adhesion to Podoplanin and regulation of Podoplanin signaling, thereby contributing to lymphatic vasculature development.PMID:25368330
Podoplanin regulates actomyosin contractility in fibroblastic reticular cells.PMID:25347465
The results of this study confirm that expression of PDPN is part of the normal host response to brain injury and gliomas.PMID:25470350
These data indicate that sialylated O-glycans of PDPN are essential for platelet adhesion and prevent PDPN from proteolytic degradation primarily mediated by MMPs in the lymph.PMID:25336627
These data suggest that the function of Pdpn in lymphangiogenesis does not depend on threonine 34 in the CLEC-2 binding domain and that PdpnT34A-Fc might be an improved inhibitor of lymphangiogenesis with fewer toxic side effects.PMID:24907275
knock-out mice diosplay delayed T regs differentiationPMID:23912054
local sphingosine-1-phosphate release after PDPN-CLEC-2-mediated platelet activation is critical for high endothelial venules integrity during immune responsesPMID:23995678
PKA can phosphorylate PDPN to decrease cell migration.PMID:23530051
podoplanin would be a useful Th17 cell marker for diagnosing pathological conditions of autoimmune diseases, including rheumatoid arthritis.PMID:23287598
a lectin from the seeds of Maackia amurensis (MASL) with affinity for O-linked carbohydrate chains containing sialic acid targets PDPN to inhibit transformed cell growth and motilityPMID:22844530
activation of CLEC-2 by PDPN rearranges the actin cytoskeleton in dendritic cells to promote efficient motility along stromal surfaces.PMID:22884313
Podoplanin is regulated by AP-1 and promotes platelet aggregation and cell migration in osteosarcomaPMID:21801875
A transmembrane glycoprotein, gp38, is a novel marker for immature hepatic progenitor cells in fetal mouse livers.PMID:21104040
Immunogenicity of a chemoenzymatically produced Tn-glycopeptide derived from the putative murine podoplanin O-glycopeptide epitope, was investigated.PMID:20721622
Pdpn positive cells are involved in lymphangiogenesis and lymphatic vasculogenesis.PMID:20855662
podoplanin was expressed on a subset of F4/80(+) macrophages; a subset which was termed fibroblastic macrophages during zymosan peritonitis.PMID:20682314
A nonhemostatic pathway in which platelet CLEC-2 receptors bind lymphatic endothelial PDPN and activate SLP-76 signaling to regulate embryonic vascular development.PMID:20363774
Loss of podoplanin is asociated with non-separation of blood and lymphatic circulation.PMID:20110424
SRC induces podoplanin expression to promote cell migrationPMID:20123990
findings show that adult LTi-like cells require extrinsic signals from podoplanin(+) splenic stromal cells to survive and suggest that IL-7 is not necessary to mediate their survival in the adult spleen.PMID:19950181
T1alpha and caveolin-1 are located in distinct plasma membrane microdomains, which differ in their protein-lipid interactions.PMID:20054149
cloning and expression in the mouse glomerulusPMID:12032185
in the absence of T1alpha protein, lung alveolar epithelial type I cell differentiation is blocked, as indicated by smaller airspaces, many fewer attenuated type I cells, and reduced levels of aquaporin-5 mRNA and proteinPMID:12654292
The role of T1a in vascular development and the effects of gene disruption in mice were studied. In cultured endothelial cells T1a promotres cell adhesion, cell movement and tube formation.PMID:12853470
RANDAM-2 nucleotide sequence completely matched that of PA2.26 antigen. RANDAM-2 is one of the type I membrane surface antigens constitutively expressed on undifferentiated neuronal cells and the glutamatergic neuronal cells during mouse neurogenesisPMID:12929128
Expression of Aggrus induced platelet aggregation without requiring plasma components. The highly conserved platelet aggregation-stimulating domain was identified.PMID:14522983
podoplanin induces an alternative pathway of tumor cell invasion in the absence of epithelial-mesenchymal transitionPMID:16616332
Freshly isolated primary osteoblasts are negative for E11 expression but begin to express this protein in culture, and expression increases with time, suggesting differentiation into the osteocyte phenotype.PMID:16738320
T1alpha may play a role in normal lung morphogenesis; mice lacking lung differentiation gene T1alpha fail to form expanded alveolar sacs, resulting in respiratory failure at birth.PMID:16869965
findings show wild-type protein could be transformed into a tumor-specific antigen; a somatic mutation in Cosmc gene abolished function of a glycosyltransferase disrupting O-glycan Core 1 synthesis & creating a tumor-specific glycopeptidic neo-epitopePMID:17038624
Show
More
Hide
All
Subcellular Location
Membrane; Single-pass type I membrane protein. Cell projection, lamellipodium membrane; Single-pass type I membrane protein. Cell projection, filopodium membrane; Single-pass type I membrane protein. Cell projection, microvillus membrane; Single-pass type I membrane protein. Cell projection, ruffle membrane; Single-pass type I membrane protein. Membrane raft. Apical cell membrane. Basolateral cell membrane. Cell projection, invadopodium.
Protein Families
Podoplanin family
Tissue Specificity
Detected at high levels in lung and brain, at lower levels in kidney, stomach, liver, spleen and esophagus, and not detected in skin and small intestine. Expressed in epithelial cells of choroid plexus, ependyma, glomerulus and alveolus, in mesothelial ce