Home
Product
Protein
Transmembrane Proteins
Recombinant Mouse Platelet glycoprotein Ib beta chain (Gp1bb)

Recombinant Mouse Platelet glycoprotein Ib beta chain (Gp1bb)

Code: CSB-CF009686MO

Rate （N/A）
Review （0）

Size:

20μg100μg

US$3841

Quantity:

Express system: in vitro E.coli expression system

Species: Mus musculus (Mouse)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Gp1bb

Uniprot NO.

P56400

Alternative Names

Gp1bb; Platelet glycoprotein Ib beta chain; GP-Ib beta; GPIb-beta; GPIbB; CD antigen CD42c

Species

Mus musculus (Mouse)

Source

in vitro E.coli expression system

Expression Region

27-206

Target Protein Sequence

PAPCSCAGTLVDCGRRGLTWASLPAAFPPDTTELVLTGNNLTALPPGLLDALPALRAAHLGANPWRCDCRLLPLRAWLAGRPERAPYRDLRCVAPPALRGRLLPYVAEDELRAACAPGLLCWGALVAQLALLVLGLLHALLLALLLGRLRRLRARARARSIQEFSLTAPLVAESARGGAS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Gp-Ib, a surface membrane protein of platelets, participates in the formation of platelet plugs by binding to von Willebrand factor, which is already bound to the subendothelium.

Gene References into Functions

These results indicate that Reelin is an important regulator of GPIb-mediated platelet activation and may represent a new therapeutic target for the prevention and treatment of cardio- and cerebrovascular diseases PMID:28943410
Role of GPIbbeta in modulating vWF mediated platelet adhesion. PMID:11816713

Hide All

Subcellular Location

Membrane; Single-pass type I membrane protein.

Database Links

UNIGENE: Mm.475622

KEGG: mmu:14724

STRING: 10090.ENSMUSP00000059270

Promotions