Recombinant Mouse Platelet glycoprotein IX (Gp9)

Code: CSB-CF009690MO
Size:
20μg
20μg100μg
US$3699
Quantity:
Express system: in vitro E.coli expression system
Species: Mus musculus (Mouse)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
Gp9
Uniprot NO.
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
17-177
Target Protein Sequence
TQACPRPCTCQSLETMGLKVNCEGQGLTALPVIPAHTRQLLLANNSLRSVPPGAFDHLPQLWDLDVTHNPWHCDCSLTYLRLWLEDHMPEALMHVYCASPDLATRRPLGQLTGYELGSCGWKLPPSWAYPGVWWDVSLVAVAVLGLILLAGLLNTFTESRN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
The GPIb-V-IX complex functions as the vWF receptor and mediates vWF-dependent platelet adhesion to blood vessels. The adhesion of platelets to injured vascular surfaces in the arterial circulation is a critical initiating event in hemostasis. GP-IX may provide for membrane insertion and orientation of GP-Ib.
Gene References into Functions
  1. Platelet GP Ib-IX can be considered a multifunctional participant in hemostasis, thrombosis, and the inflammatory cascade. PMID:24504734
  2. These data indicate an important role for the platelet adhesion receptor GPIb-IX in endotoxin-induced thrombosis and thrombocytopenia. PMID:24051142
  3. Letter: report autoantibody response to GPIb/IX in a regulatory T-cell-deficient mouse model for immune thrombocytopenia. PMID:23176290
  4. A Lyn-Vav-Rac1-PI3K-Akt pathway mediates von Willebrand factor-induced activation of integrin alpha(IIb)beta(3) to promote GPIb-IX-dependent platelet activation. PMID:22995516
  5. Data indicate that GPIX is the subunit of the glycoprotein Ib-IX-V complex that binds to grp94/Hsp90b1; the glycoprotein Ib-IX-V complex is stabilized by grp94/Hsp90b1. PMID:21576699
  6. Findings point to a role of the GPIb-V-IX complex intrinsic to megakaryocytes at the stage of proplatelet formation and suggest a functional link with the underlying microtubular cytoskeleton in platelet biogenesis. PMID:19377075

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products