Recombinant Mouse Platelet-activating factor receptor (Ptafr)

Code: CSB-CF018946MO
Size:
20μg
20μg100μg
US$5046
Quantity:
Express system: in vitro E.coli expression system
Species: Mus musculus (Mouse)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
Ptafr
Uniprot NO.
Alternative Names
Ptafr; Platelet-activating factor receptor; PAF-R; PAFr
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
1-341
Target Protein Sequence
MEHNGSFRVDSEFRYTLFPIVYSVIFILGVVANGYVLWVFANLYPSKKLNEIKIFMVNLT MADLLFLITLPLWIVYYYNEGDWILPNFLCNVAGCLFFINTYCSVAFLGVITYNRYQAVA YPIKTAQATTRKRGISLSLIIWVSIVATASYFLATDSTNLVPNKDGSGNITRCFEHYEPY SVPILVVHVFIAFCFFLVFFLIFYCNLVIIHTLLTQPMRQQRKAGVKRRALWMVCTVLAV FIICFVPHHVVQLPWTLAELGYQTNFHQAINDAHQITLCLLSTNCVLDPVIYCFLTKKFR KHLSEKFYSMRSSRKCSRATSDTCTEVIVPANQTPIVSLKN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Receptor for platelet activating factor, a chemotactic phospholipid mediator that possesses potent inflammatory, smooth-muscle contractile and hypotensive activity. Seems to mediate its action via a G protein that activates a phosphatidylinositol-calcium second messenger system.
Gene References into Functions
  1. Our results thus define a key inflammatory molecule PAF that participates in the neuroinflammation and helps bring about cerebral dysfunction during the TBI acute phase. PMID:28094295
  2. PAFR role in modulating activation of NF-kappaB and in the pro- and anti-inflammatory responses during toll-like receptor activation in in macrophages. PMID:27554194
  3. this study shows that tumors grew less in PAFR KO mice PMID:29445756
  4. The findings above were confirmed in lipopolysaccharide (LPS)-incubated cardiomyocytes with or without PAFR expressions in vitro. In summary, we supposed that inhibiting PAFR reduced inflammation, oxidative stress and apoptosis, and thus might be a promising therapeutic strategy to alleviate myocardial I/R injury. PMID:29278700
  5. PAFR null mutant mice showed a better functional recovery in grip and rotarod performances than wild-type mice. PMID:26084439
  6. Results show that CD36 and Platelet-Activating Factor Receptor are important mediators of house dust mites (HDM) allergy development and that inhibiting HDM engagement with phosphorylcholine receptors in the lung protects against allergic airway disease. PMID:28667161
  7. Study demonstrated that PAFR has a compelling involvement in Brucella abortus uptake as a promoter of phagocytosis, which is associated with JAK2 signaling activation. PMID:27098179
  8. In the absence of PAFR signalling, monocytes and macrophages acquire a pro-inflammatory phenotype, resulting in adipose tissue inflammation and metabolic dysfunction. PMID:26785675
  9. Data (including data from studies in knockout mice) suggest that signal transduction via platelet-activating factor (PAF) and PAF receptor is involved in regulation of lipid metabolism/inflammation in liver of mice on high-refined carbohydrate diet. PMID:26013469
  10. ExoU activates NF-kappaB by PAFR signalling, which in turns enhances PAFR expression, highlighting an important mechanism of amplification of response to this P. aeruginosa toxin. PMID:24612488
  11. In PAF receptor-knockout mice, diet-induced obesity is exacerbated. PMID:25577975
  12. Bacteria did not associate with PAFR, indicating an indirect role of PAFR in pneumococcal adhesion to endothelial cells. PMID:24841255
  13. PAFR deficiency resulted in less inflammation in adipose tissue and improvement in glucose homeostasis in mice fed a high-carbohydrate diet PMID:24339378
  14. PAFR and CD36 coimmunoprecipitated with flotillin-1, a constitutive lipid raft protein, and disruption of these membrane microdomains by methyl-beta-cyclodextrin reduced apoptotic cells phagocytosis PMID:24347838
  15. Our findings establish the existence of a functional partnership PAF-R/eNOS on endothelial cell plasma membrane. PMID:24086643
  16. PAFR signaling contributes to a pro-inflammatory environment in the model of obstructive nephropathy, favoring the fibrotic process. PMID:24492283
  17. propose for the first time that PAF/PAF-R can mediate dopaminergic degeneration via an NF-kappaB-dependent signaling process PMID:23743065
  18. EfLTA induces the expression of chemokines via signaling pathways requiring TLR2 and PAFR, which is distinct from that of LPS-induced chemokine expression. PMID:23964117
  19. Blockade of platelet-activating factor receptor may contribute to the progression of periodontal disease triggered by Aggregatibacter actinomycetemcomitans by directly affecting the differentiation and activity of osteoclasts. PMID:24002061
  20. Therefore, PAFR activation is crucial in the pathogenesis of pulmonary damage associated with Plasmodium berghei ANKA strain infection in C57Bl/6 mice. PMID:23260771
  21. recognition of apoptotic cells by phagocytes leads to activation of PAFR pathways, resulting in a microenvironment response favorable to melanoma growth PMID:22577252
  22. PAFR may have a role in tumor response mechanisms, such as stress responses caused by chemotherapeutic agents PMID:22570511
  23. PAFR on donor leukocytes plays a critical role in GVHD by mediating leukocyte influx and cytokine production in target tissues. PMID:22301794
  24. findings suggest PAFR acts to suppress PMA-induced chronic inflammation; and PAFR acts to suppress neoplastic development in response to chemical carcinogens PMID:22223848
  25. Absence of PAF receptor results in a milder form of experimental autoimmune encephalomyelitis with altered types of inflammatory mediators and infiltrating cells in central nervous system (CNS) tissue. PMID:21338585
  26. PAFR is a disease-associated gene and plays an important role in driving neutrophil influx and lung damage after infection of mice with two subtypes of Influenza A. PMID:21079759
  27. PAF-R-dependent pathways are activated during experimental tumour growth, modifying the microenvironment and the phenotype of the tumour macrophages in such a way as to favour tumour growth. PMID:20465821
  28. Results reveal that some strains of Gram-positive bacteria exploit hypoxia-inducible factor 1 alpha-regulated platelet-activating factor receptor as a means for translocation through intestinal epithelial cells. PMID:20032301
  29. Degradation of platelet-activating factor (PAF) was examined by incubating PAF with macrophages from PAF receptor-deficient mice PMID:11786559
  30. PAF receptor senses cellular damage through the recognition of PAF and/or PAF-like molecules, such as oxidized phosphatidylcholine, which activates cytokine transcription and induces systemic immune suppression PMID:11805144
  31. embryonic-PAF does not appear to regulate expression of its own receptor in vitro PMID:11958508
  32. present studies firmly establish a role of PAFR activation for the local, remote and systemic inflammatory injury and lethality which follows reperfusion of the ischemic superior mesenteric artery PMID:12812996
  33. results are consistent with the hypothesis that activation of PAF receptors control T. cruzi replication in great part via facilitation of the uptake of the parasite and consequent activation of macrophages PMID:12850205
  34. PAFR deficient mice were relatively resistant to pneumococcal pneumonia. PMID:14767826
  35. Mice deficient in the cell surface receptor for PAF (PAFR-/-), a bioactive mediator of oxidative stress and inflammation, are protected from the spatial reference learning deficits associated with Intermittent hypoxia during sleep PMID:15030403
  36. PAFR expression and/or function underlies critical components of intermittant hypoxia-induced long term ventilatory facilitation but does not play a role in the potentiation of the hypoxic ventilatory response after exposures. PMID:15087283
  37. In organ cultures, bone resorption was significantly suppressed by a PAF receptor antagonist treatment or genetic PAF receptor deficiency. PMID:15232615
  38. PAFR does not interfere with the clearance of nontypeable Haemophilus influenzae from the respiratory tract PMID:15545826
  39. Pneumococcus uses the PAFR leading to severe pneumonia in a host previously exposed to influenza A. PMID:16100290
  40. UVB photo-oxidizes cellular phospholipids, creating PAF analogs that stimulate the PAF receptor to induce further PAF synthesis and apoptosis PMID:16115894
  41. The association of beta-arrestin with the platelet-activating factor receptor contributes to successful translocation of pneumococci. PMID:16299272
  42. Platelet activating factor (PAF) receptor is involved in mediating gram-negative bacterial uptake associated with transcytosis in isolated murine intestinal segments PMID:16369019
  43. PAF is involved in pathogenesis of folic acid-induced renal injury by activating neutrophils in acute phase and macrophages in chronic interstitial fibrosis. Inhibiting the PAF pathway might be therapeutic to kidney injury from inflammatory cells. PMID:16651609
  44. PAFR mediates early impairment of neutrophil migration toward the infectious focus during lethal sepsis caused by cecum ligation and puncture in mice. PMID:16818786
  45. PAFr shepherds phosphorylcholine-containing bacterial components such as the cell wall into host cells from where the response ranges from quiescence to severe pathophysiology. PMID:17056547
  46. We conclude that PAFr plays an important role in hypersusceptibility to pneumococcal infection in sickle cell disease. PMID:17230418
  47. the enhanced in vitro adherence of pneumococci to respiratory epithelium seen following incubation with influenza virus is not mediated solely by PAFR(platelet-activating factor receptor ) PMID:17852951
  48. epidermal PAF-R can modulate UVB-mediated early gene expression PMID:17928889
  49. Deficiency of platelet-activating factor receptor greatly diminishes acute lung inflammation induced by bacterial lipoteichoic acid in vivo. PMID:18292574
  50. platelet-activating factor receptor and serotonin receptor may have roles in photocarcinogenesis PMID:18483284

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Found in a range of organs. Expressed most strongly in spleen, followed by skeletal muscle, lung and small intestine. Expressed at moderate levels in the heart. Expressed at relatively low levels in the brain, liver and kidney.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products