Adcyap1r1; Pituitary adenylate cyclase-activating polypeptide type I receptor; PACAP type I receptor; PACAP-R-1; PACAP-R1
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
21-496
Target Protein Sequence
MHSDCIFKKEQAMCLERIQRANDLMGLNESSPGCPGMWDNITCWKPAQIGEMVLVSCPEV FRIFNPDQVWMTETIGDSGFADSNSLEITDMGVVGRNCTEDGWSEPFPHYFDACGFDDYE PESGDQDYYYLSVKALYTVGYSTSLVTLTTAMVILCRFRKLHCTRNFIHMNLFVSFMLRA ISVFIKDWILYAEQDSSHCFVSTVECKAVMVFFHYCVVSNYFWLFIEGLYLFTLLVETFF PERRYFYWYTIIGWGTPTVCVTVWAVLRLYFDDAGCWDMNDSTALWWVIKGPVVGSIMVN FVLFIGIIIILVQKLQSPDMGGNESSIYFSCVQKCYCKPQRAQQHSCKMSELSTITLRLA RSTLLLIPLFGIHYTVFAFSPENVSKRERLVFELGLGSFQGFVVAVLYCFLNGEVQAEIK RKWRSWKVNRYFTMDFKHRHPSLASSGVNGGTQLSILSKSSSQLRMSSLPADNLAT
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
This is a receptor for PACAP-27 and PACAP-38. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. May regulate the release of adrenocorticotropin, luteinizing hormone, growth hormone, prolactin, epinephrine, and catecholamine. May play a role in spermatogenesis and sperm motility. Causes smooth muscle relaxation and secretion in the gastrointestinal tract.
Gene References into Functions
PACAP/PAC1 signaling is important for light regulated behavior, VIP/VPAC2 signaling for stable clock function and both signaling pathways may play a role in shaping diurnality versus nocturnality.PMID:29155851
Its signaling evokes long-lasting nociceptive behaviors through the activation of spinal astrocytes.PMID:26948958
The results suggested that sympathetic nerve innervation may be responsible for Pituitary adenylate cyclase-activating polypeptide-regulated hematopoiesis in bone marrow, mainly via PAC1.PMID:26925806
spinal astrocytic activation triggered by the PAC1 receptor stimulation contributes to both induction and maintenance of the long-term mechanical allodynia.PMID:27175011
PACAP/PAC1 signaling has a role in light regulated food anticipatory activityPMID:26757053
PAC1 plays a prominent role in chronic restraint stress response, but less so in the acute restraint stress response.PMID:25853791
overexpression of Pac1 rescued the Zac1 knockdown neuronal migration phenotypePMID:26424889
PAC1 has ligand-independent and dimer-dependent intrinsic/basal activity, conferring cells with anti-apoptotic activities against serum withdrawal, which is involved in the Wnt/beta-catenin signal and is associated with the endocytosis of PAC1 dimers.PMID:25426938
PACAP and PAC1-R expression increased in cumulus cells isolated at different times after treatment with human chorionic gonadotropin.PMID:23684890
These results suggest that Sp1 cross-linking might be crucial in negative regulation of PAC1 gene expression due to TG2 in OGD-induced ER stress.PMID:24045949
This study demonistrated that pac1r expression in reactive astrocytes induced by global brain ischemia in mice.PMID:23564104
PAC1R mRNA expression in the hippocampus was significantly elevated on day 7 after ischemia induced by bilateral common carotid artery occlusion. .PMID:22669509
PAC1R transcript expression exhibited differential responses in NGF-OE mice that were tissue (urothelium vs. detrusor) cyclophosphamide-induced-cystitis duration-dependent.PMID:22700375
We conclude that PACAP/PAC1R signaling is involved in the sustained phase of the pupillary light reflex at high irradiances.PMID:22459045
current results show that the action of GnRH in the regulation of gonadotropin subunit expression is enhanced by the presence of PAC1RsPMID:21658369
Increased PAC1R mRNA expression in lung tissue was present under inflammatory conditionsPMID:21059121
Results indicate that the expression of PAC1 is clearly important for maintaining the homeostasis of gastric acid secretion.PMID:20821075
Data describe PACAP, vasoactive intestinal polypeptide, and PAC1, VPAC1, VPAC2 transcripts or protein expression in urothelium and detrusor smooth muscle and lumbosacral dorsal root ganglia in NGF-overexpressing and wildtype mice.PMID:20449688
data suggest that perturbations in the PACAP-PAC1 pathway are involved in abnormal stress responses underlying post-traumatic stress disorderPMID:21350482
PACAP may therefore function through PAC1 receptors to protect neurons from cell death during inflammatory cytokine releasePMID:20654718
data from LbetaT2 cell line suggest that PAC1-R and PACAP are produced locally within the gonadotrophs following GnRH stimulation; possible role in gene expression regulation of gonadotropin alpha subunitsPMID:20553777
The data of this study demonstrated that an appropriate level of PACAP signaling is required for normal retinogenesis and visual function. This finding may have implications in GABAergic neuron-related neurological conditions.PMID:19596361
PAC1 variants expressed in mouse pancreatic islets seem to be coupled to adenylate cyclase but not to PLC.PMID:11897681
PAC1 receptor is solely responsible for the PACAP-induced [Ca2+]i signalling and secretion of vasopressin and oxytocin in the somatodendritic region of supraoptic neuronesPMID:12899682
At threshold LTP of PACAP+/- mice was impaired greater than the one of PAC1R-/- mice. Thus, both PACAP and PAC1R could contribute to the establishment of LTP in a gene dosage-dependent manner.PMID:14600504
In vivo PAC1-mediated signaling seems to play a pivotal role for the transcriptional regulation of brain derived neurotrophic factor, as demonstrated in PAC1 mutants with alterations in hippocampal expression of BDNF and its receptor TrkB.PMID:15082190
PAC1 signaling is an important factor in the development and/or functioning of neural pathways associated with pheromone processing and the regulation of social interactions in mice.PMID:15470144
The absence of PAC1 causes pulmonary hypertension and right heart failure after birth. These in vivo findings demonstrate the crucial importance of PAC1-mediated signaling for the maintenance of normal pulmonary vascular tone during early postnatal life.PMID:15520307
PAC1 receptor is involved in neutrophil recruitment in different target organs, in adhesion molecules expression, and in coagulation-related molecule fibrinogen synthesis.PMID:15661828
PAC1 receptor signaling in the suprachiasmatic nucleus in response to light stimulation induces a down-regulation of CaM expression and that CaM is involved in the photic-entrainment mechanismPMID:15800378
fibrinogen expression through PAC1 receptor, providing an advantage to design more specific drugs complementing standard intensive care therapy in septic shockPMID:16888200
PAC1(3a) was originally discovered in testes as another potential regulator in rat astrocytesPMID:16888214
assessed the binding affinity and ability to stimulate adenylyl cyclase of the PCA1 variant-expressing cells for pituitary adenylate cyclase-activating polypeptidePMID:16888230
These results suggest that the PACAP/PAC1 system may play a dual role in neural/glial progenitor cells not only differentiation but also proliferation in the cortical astrocyte lineage via Ca2+-dependent signaling pathways through PAC1.PMID:17115416
the combination of alternative splicing events in the EC1 domain and the IC3 loop create a variety of PAC1 isoforms, which in turn may contribute to the functional pleiotropism of PACAP.PMID:17442841
PACAP may participate in the neurodevelopment with the stage-specific expression of PAC1R and that PACAP plays important roles in neurons as well as in glial cellsPMID:17900711
All of the activity-dependent neuroprotective protein-immunopositive cells co-localized with PAC1R immunoreactivityPMID:17942168
Results suggest that endogenous PACAP plays an important role in cell survival during cerebellar development, through the activation of the PAC1 receptor.PMID:18409023
Results suggest that PAC1-R may play a gating role in passage permitting through perception of geomagnetic orientation and fear signals, but not perception of visual orientation, and it regulates behavioral performance in retrieval of memory in mice.PMID:18781286
Mice lacking the PACAP type I receptor have impaired photic entrainment and negative masking.PMID:18922961
beta-Arrestin 1 is required for PAC1 receptor-mediated potentiation of long-lasting ERK1/2 activation by glucose in pancreatic beta-cells.PMID:19074139