MAIAHLATEYVFSDFLLKEPTEPKFKGLRLELAVDKMVTCIAVGLPLLLISLAFAQEISI GTQISCFSPSSFSWRQAAFVDSYCWAAVQQKSSLQSESGNLPLWLHKFFPYILLLFAILL YLPALFWRFSAAPHLCSDLKFIMEELDKVYNRAIKAAKSARDLDLRDGPGPPGVTENVGQ SLWEISESHFKYPIVEQYLKTKKNSSHLIMKYISCRLVTFVVILLACIYLSYYFSLSSLS DEFLCSIKSGVLKNDSTIPDRFQCKLIAVGIFQLLSLINLIVYALLIPVVVYTFFIPFRQ KTDILKVYEILPTFDVLHFKSEGYNDLSLYNLFLEENISELKSYKCLKVLENIKSNGQGI DPMLLLTNLGMIKMDIIDGKIPTSLQTKGEDQGSQRVEFKDLDLSSEAAANNGEKNSRQR LLNPSC
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Structural component of the gap junctions and the hemichannels. May play a role as a Ca(2+)-leak channel to regulate ER Ca(2+) homeostasis.; Structural component of the gap junctions and the hemichannels involved in the ATP release and nucleotide permeation. May play a role as a Ca(2+)-leak channel to regulate ER Ca(2+) homeostasis. Plays a critical role in oogenesis.
Gene References into Functions
Panx1 expressed in immune cells is critical for pain-like effects following nerve injury in mice, perhaps via a GPCR-mediated activation mechanism, and suggest that inhibition of Panx1 may be useful in treating neuropathic pain.PMID:28195232
Auditory brainstem response thresholds in the Gen-Panx1 KO mouse were significantly increased. Distortion product otoacoustic emission and cochlear microphonics were significantly reduced.PMID:29710868
These novel findings reveal unique roles for GFAP-positive glial and neuronal Panx1 and describe new chronic pain targets for cell-type specific intervention in this often intractable disease.PMID:27910899
Panx-1 modulation may be interesting to amplify the clinical effect of cisplatin (DDP) and reverse the resistance of testicular cancer cells to DDP.PMID:28780469
Pannexin1 may play a role in the pathogenesis of liver disease.PMID:29246445
Findings indicate a deleterious role for membrane channel Pannexin 1 (Panx1) in response to permanent permanent middle cerebral artery (MCA) occlusion, that is unique to females.PMID:28445139
ATP release from red blood cells is not mediated by the cAMP-mediated Panx1 pathway.PMID:28855161
blocking Panx1 and/or Casp4 activities is a beneficial strategy to enhance donor cell engraftment and LG regeneration through the reduction of inflammation.PMID:29098296
found a significant increase in waking and a correspondent decrease in slow wave sleep percentages in the Panx1-/- animals.PMID:27769744
Diabetic C57BL/6J-Ins2Akita mice were used to evaluate in vivo effects of high glucose on P2R and Panx1PMID:27159053
Pharmacological blockade or genetic deletion of Panx1 channels inhibits CD4+ T lymphocyte polarization and migration induced by the chemokine SDF-1alpha/CXCL12. Panx1 deficiency delayed experimental autoimmune encephalomyelitis symptoms because of the decreased infiltration of CD4+ T lymphocytes into the CNS.PMID:27076682
data suggest that Panx1 and Panx3 are not essential for baseline hearing in mice tested, but the therapeutic targeting of Panx3 may prove protective against mid-high-frequency hearing loss caused by loud NE.PMID:27784763
Pannexin1 (Panx1) is dynamically regulated throughout mammary gland development.PMID:27099931
Panx1 is expressed in the central and peripheral nervous system during early developmental stages.PMID:26453396
this study provides the first demonstration of Panx1 channel morphology and assembly in intact cells.PMID:26386583
Panx1 in the heart influences different electrophysiological parameters involving depolarization, repolarization and atrial vulnerability causing atrial fibrillation.PMID:26828725
ATP released by myocardial cells through Pannexin-1 channel during ischemia could evoke calcium responses in cardiac sympathetic nerve fibers.PMID:26596404
Platelets of Panx1-/- mice showed reduced collagen-induced aggregation as compared to those of WT mice.PMID:25947940
The observations of this study reveal a new role for Panx1 in NPC maintenance in the VZ and suggesting that targeting peri-infarct Panx1 (in combination with other interventions) could improve outcomes after stroke.PMID:26818508
The role of Pannexin 1 is analyzed at the systems level, it is not required for normal taste perception. Further studies are needed to determine the role of this hemichannel in taste cells.PMID:26126730
Panx1 channels promote leukocyte adhesion and emigration through the venous wall during acute systemic inflammation.PMID:26242575
The PANX1 is unnecessary for taste detection and consequently that ATP release from Type 2 taste cells does not require PANX1.PMID:25987548
Pannexin1 channels dominate ATP release in the cochlea ensuring endocochlear potential and auditory receptor potential generation and hearingPMID:26035172
But not in Casp11(-/-), Panx1(-/-), or P2x7(-/-) mice.PMID:26572062
Px1 channels releasing ATP have any role in the constrictor actions of alpha1-adrenoceptor activationPMID:25637780
A molecular signature in the pannexin1 intracellular loop confers channel activation by the alpha1 adrenoreceptor in smooth muscle cells.PMID:25690012
Hydrolysable ATP is the most potent stimulator of Panx1 internalization. Two possible mechanisms for Panx1 internalization include activation of P2X receptors and involvement of a putative ATP-sensitive residue in the first extracellular loop of Panx1.PMID:26195825
These findings indicate that Panx1 participates in urothelial mechanotransduction and signaling by providing a direct pathway for mechanically-induced ATP release and by functionally interacting with P2X7RsPMID:25170954
Deletion of Panx1 in the cochlea could produce a progressive hearing loss. The auditory brainstem response (ABR) recording showed that hearing loss was moderate to severe and severe at high-frequencies.PMID:26002464
activation of Panx1/P2X7 purinoceptors appears to play a significant role in the neuroprotective mechanism of ischemic postconditioning.PMID:25796110
Application of P1-receptor antagonist and apyrase significantly reduced this component in WT, but not in KO mice, indicating participation of ATP released via Panx1 in the EDH-like relaxation.PMID:25819435
These results show that P2X7 receptors and pannexin-1 channels are major mediators of postanoxic depolarization in neurons and of brain damage after ischemiaPMID:25605289
The two channel states were associated with different reactivities of the terminal cysteine of Panx1 to thiol reagents, suggesting different conformations.PMID:25056878
Study found that astrocytes released ATP in response to mechanical strain, with pannexin 1 the predominant efflux pathwayPMID:24839011
The cytoplasmic domains of pannexin 1 is transmembrane domains uncovered a potential membrane interacting region (I360-G370) located upstream of the caspase cleavage site (D375-D378) within the pannexin 1 CT domain.PMID:24751934
Panx1 channels serves as the main cell membrane pathway for ATP-induced uptake of small molecules and mediates the ATP-induced T-cell death.PMID:24590064
The Panx1 C-terminus plays an important role in channel trafficking and highlight the complexity of molecular signals involved.PMID:23659289
5-Lipoxygenase inhibitor activation of Panx1 channels involves activation of the thromboxane receptor via the cAMP/PKA pathway.PMID:25080488
This study's findings suggest a new function of Pannexin1 as an important player in normal endothelium-dependent regulation of arterial tone, where it facilitates vessel dilation and attenuates constriction.PMID:24885326
These findings suggest that nonmetal hapten reactivity to thiol residues causes membrane disruption of keratinocytes and reactive oxygen species production that leads to ATP release through opening of Panx hemichannels.PMID:24531690
We conclude that Panx1 controls cellular properties of keratinocytes and dermal fibroblasts during early stages of skin development and modulates wound repair upon injury.PMID:24522432
This report provides immunocytological and functional evidence for a role of Panx1 HCs in adult skeletal muscles.PMID:23583931
data identify a novel linkage between an antibiotic, pannexin channels and cellular integrity, and suggest that re-engineering certain quinolones might help develop newer antibacterialsPMID:24646995
shows that a Panx1 dependent mechanism (ATP release and/or inflammasome activation) contributes to disease progression, and that inhibition of Panx1 using pharmacology or gene disruption delays and attenuates clinical signs of EAEPMID:23885286
Panx1 regulates neural stem and progenitor cell behaviours associated with cytoskeletal dynamics and interacts with multiple cytoskeletal elements.PMID:23964896
propose that Panx1 signaling provides a positive feedback loop for inflammatory responses involved in bladder dysfunction in MSPMID:23827947
Panx1-/- mice carried much more F4/80lowGr1-Ly6C- cells in the peritoneal cavity, indicating that this population is neither inflammatory monocytes nor classical macrophages.PMID:23549611
The results of this study suggested that Panx1 channels serve as sinks for extracellular current flow making them possible candidates for the mediation of feedback from horizontal cells to photoreceptors.PMID:22965528
). Pannexin double-knockout mice (Px1(-/-) Px2(-/-)) were less impaired in parameters such as exploration, anxiety, sensorimotor function and behavioral symmetry.PMID:23111424
Panx1 alone forms a channel that has insufficient permeability to ATP.PMID:22956545