MAADLEPWNSTINGTWEGDELGYKCRFNEDFKYVLLPVSYGVVCVLGLCLNVVALYIFLC RLKTWNASTTYMFHLAVSDSLYAASLPLLVYYYARGDHWPFSTVLCKLVRFLFYTNLYCS ILFLTCISVHRCLGVLRPLHSLRWGRARYARRVAAVVWVLVLACQAPVLYFVTTSVRGTR ITCHDTSARELFSHFVAYSSVMLGLLFAVPFSVILVCYVLMARRLLKPAYGTTGGLPRAK RKSVRTIALVLAVFALCFLPFHVTRTLYYSFRSLDLSCHTLNAINMAYKITRPLASANSC LDPVLYFLAGQRLVRFARDAKPPTEPTPSPQARRKLGLHRPNRTVRKDLSVSSDDSRRTE STPAGSETKDIRL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Receptor for ATP and UTP coupled to G-proteins that activate a phosphatidylinositol-calcium second messenger system. The affinity range is UTP = ATP > ATP-gamma-S >> 2-methylthio-ATP = ADP.
Gene References into Functions
The P2Y2R enhances Ubiquitin-Proteasome System activity by increasing the subunits expression beta 5 and beta 1.PMID:27768902
The results of this study suggest that P2Y2Rs contribute to the development of salivary gland inflammation in IL-14alphaTG mice and may also contribute to autoimmune sialadenitis in humans.PMID:29297959
Our results clearly demonstrate the involvement of P2Y2R subtypes in the pathogenesis of fibrotic lung diseases in humans and mice and hence support the development of selective P2Y2R antagonists for the treatment of IPF.PMID:28415591
knockdown of P2Y2R retarded cyst expansion in vitro and prevented ATP- and HIF-1alpha-dependent cyst growth. In conclusion, P2Y2R mediates ATP-dependent cyst growth and is transcriptionally regulated by HIF-1alpha.PMID:27565965
P2Y2R is an inhibitor of arterial intimal calcification, regulating the osteoblastic trans-differentiation of smooth muscle cells through P2Y2R-mediated Runx2 antagonism.PMID:28038380
These findings are consistent with the notion that the primary action of P2Y2 receptor signalling in bone is to regulate extracellular ATP levels.PMID:28420708
Results demonstrate that P2Y2 contributes to response properties of cutaneous afferents, as P2Y2 deletion reduces responsiveness of conventional unmyelinated polymodal afferents to heat and appears to result in the acquisition of mechanical responsiveness in a subset of TRPV1-expressing afferents.PMID:27393251
This study suggests that P2Y2 may participate in cardiomyopathy in mdx mice.PMID:27220808
Extracellular ATP induces vascular inflammation and atherosclerosis via activation of P2Y2.PMID:27339459
Endothelial cell-specific P2Y2R deficiency reduces atherosclerotic burden and promotes plaque stability in ApoE(-/-) mice through impaired macrophage infiltration acting together with reduced matrix metalloproteinase-2 activity and increased smooth muscle cell migration.PMID:27856454
Calcium-mediated purinergic receptors regulate the migration and phagocytic ability of microglia during post-natal brain development.PMID:25575683
expression of P2Y(2) receptor in peripheral sensory neurons that innervate the injured tissue and the activation of P2Y receptors contributes to mechanical allodynia following inflammationPMID:26062804
In P2Y1R (-/-) mice, the expression of P2Y2 receptor in muscle was reduced by over 50 %, as compared to P2Y1R (+/+) mice.PMID:26036470
gene deficiency restricted to hematopoietic tissues results in longer survivak after GvHDPMID:26538394
P2Y2R deficiency does not alter baseline collateral vessel formation but does significantly impair collateral maturation, with resultant persistent limb ischemia despite enhanced angiogenesis.PMID:25088742
P2Y2-/- mice are less susceptible to mount an autoimmune response against IRBPPMID:25692550
P2Y2 and Gq/G11 are required for basal endothelial NO formation, vascular tone, and blood pressure.PMID:26168216
P2Y2-mediated increase of cytoplasmic Ca(2+) concentration down-regulates the expression of NCC.PMID:24463702
P2Y2 receptors play important roles in bone marrow cell differentiation and mineralization as well as in bone cell mechanotransduction, leading to an osteopenic phenotype in P2Y2 knockout mice.PMID:25268784
P2Y2R has a role in the skin wound-healing process in mouse modelsPMID:24816122
Thus, P2Y2R activation protects cardiomyocytes from hypoxia in vitro and reduces post-ischemic myocardial damage in vivo.PMID:23828651
UTP-induced migratory responses required for salivary gland acinar cell self-organization are mediated by the P2Y2R.PMID:24760984
Osteoblasts can regulate their mechanosensitivity through P2Y2R activation leading to increased cell stiffness.PMID:24696143
Mice deficient in P2Y2 or lacking ATP secretion from platelets show strongly reduced tumor cell metastasisPMID:23810565
up-regulation of P2Y2Rs in primary cortical neurons under pro-inflammatory conditions can promote cofilin-dependent neurite outgrowth, a neuroprotective response that may be a novel pharmacological target in the treatment of neurodegenerative diseases.PMID:23550835
Stimulation of astrocytic P2Y1R receptors significantly reduces brain injury after acute trauma and is mediated by the inositol 1,4,5-trisphosphate (IP3) receptor-signaling pathway.PMID:23046422
Purinergic P2Y receptors promote neutrophil infiltration and hepatocyte death in mice with acute liver injury.PMID:22974709
Although C/EBPbeta was sufficient to induce P2Y(2) transcription, the effect of C/EBPbeta and NF-kappaB p65 on receptor transcription was synergistic.PMID:22742194
Real-time imaging reveals that P2Y2 and P2Y12 receptor agonists are not chemoattractants and macrophage chemotaxis to complement C5a is phosphatidylinositol 3-kinase (PI3K)- and p38 mitogen-activated protein kinase (MAPK)-independent.PMID:22199395
P2Y2 and P2Y12 receptor agonists are not chemoattractants and macrophage chemotaxis to complement C5a is phosphatidylinositol 3-kinase (PI3K)- and p38 mitogen-activated protein kinase (MAPK)-independent.PMID:22057273
genetic deletion of P2Y2-R offers significant resistance to the development of Li-induced polyuria, without altering blood Li levels and renal accumulation of Li, and suppression of PGE2 productionPMID:21975874
These results indicate that the P2Y(2) receptor mediates uridine-5'-triphosphate cardioprotection, in vivo.PMID:21839729
Systemic activation of P2Y(2) receptors lowers blood pressure and inhibits renal sodium reabsorption.PMID:21613580
role in chondrocyte mechanotransductionPMID:21520257
Data show that tlt and mlh mutations uncouple Otopetrin 1 from inhibition of P2Y receptor function.PMID:21236346
Heterologous down-regulation of angiotensin type 1 receptors by purinergic P2Y2 receptor stimulation through S-nitrosylation of NF-kappaB.PMID:21464294
P2Y(2) R appears to be involved in asthmatic airway inflammationPMID:20880147
Data show that autocrine purinergic receptor P2Y(2), or P2Y(12) signaling amplifies and translates chemotactic cues into directional motility.PMID:20664064
Control of ENaC by purinergic signaling (P2Y2) is necessary for aldosterone escape.PMID:20813869
Eosinophil accumulation, a distinctive feature of lung allergic inflammation, is defective in ovalbumin (OVA)-treated P2Y2 receptor-deficient mice compared with OVA-treated wild type animals.PMID:20720203
Neutralizing intrapulmonary ATP levels or blocking airway P2Y2 receptors on lung neutrophils and macrophages inhibits smoke-induced lung inflammation and confers protection from the development of emphysema.PMID:20519655
These results support involvement of P2Y(2) receptors in bladder sensation, suggesting an important contribution to bladder neuron excitability and hypersensitivity.PMID:20147562
study shows that P2Y2 receptors are expressed in cumulus cell-enclosed oocytes, and that their stimulation opens at least two different types of ion channelsPMID:12193392
Knock-out mice reveal tissue-specific roles of P2Y receptor subtypes in different epithelia.PMID:12644577
Both the P2Y2 and P2Y4 receptors are present in the luminal membrane of mouse distal colonic mucosa, and stimulation of these receptors leads to potassium ion secretion.PMID:15718265
functional interaction between endogenous P2Y2 receptor and TRPV1 channels could explain the ATP-induced painPMID:16133936
P2Y(2) has a role as a morphogen receptor that potentiates neurotrophin signaling in neuronal development and regenerationPMID:16365320
The role of P2Y2 and P2Y4 receptors in peritoneal macrophage calcium signaling is reported.PMID:16980298
I(Cl.UTP) is due to the activation of CFTR Cl- channels through Gq/11-coupled P2Y2 receptor-PLC-PKC signaling and ATP hydrolysis in mouse heartPMID:17291397
oncogenic potential of P2RY2 was confirmed in vitro with the focus formation assay as well as soft agar-growth assay, and also in vivo with a tumorigenicity assay in nude mice.PMID:17382903
Show
More
Hide
All
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Spleen, testis, kidney, liver, lung, heart and brain.