Recombinant Mouse P2Y purinoceptor 1 (P2ry1)

In Stock
Code: CSB-CF017326MO
Size:
20ug
20ug100ug
US$1620
Quantity:
Express system: in vitro E.coli expression system
Species: Mus musculus (Mouse)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Mouse P2ry1 protein
Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
P2ry1
Uniprot NO.
Research Area
Neuroscience
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
1-373aa
Target Protein Sequence
MTEVPWSVVPNGTDAAFLAGLGSLWGNSTVASTAAVSSSFQCALTKTGFQFYYLPAVYILVFIIGFLGNSVAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFGDAMCKLQRFIFHVNLYGSILFLTCISAHRYSGVVYPLKSLGRLKKKNAIYVSVLVWLIVVVAISPILFYSGTGTRKNKTVTCYDTTSNDYLRSYFIYSMCTTVAMFCIPLVLILGCYGLIVKALIYNDLDNSPLRRKSIYLVIIVLTVFAVSYIPFHVMKTMNLRARLDFQTPEMCDFNDRVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANLQSKSEEMTLNILSEFKQNGDTSL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
48.3 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Receptor for extracellular adenine nucleotides such as ADP. In platelets, binding to ADP leads to mobilization of intracellular calcium ions via activation of phospholipase C, a change in platelet shape, and ultimately platelet aggregation.
Gene References into Functions
  1. upregulation of P2Y1 in cutaneous nociceptors during early life peripheral inflammation can regulate the sensitization of myelinated nociceptors to both mechanical and heat stimuli possibly through modulation of transient receptor potential vanilloid type 1 expression PMID:28845731
  2. This study demonstrated that The inhibitory input to mouse cerebellar Purkinje cells is reciprocally modulated by Bergmann glial P2Y1 and AMPA receptor signaling. PMID:27144942
  3. LPS-induced inflammation levels were comparable in the P2Y1-null and wild-type mice. Specifically, splenomegaly, counts of circulating platelets and white blood cells (lymphocytes and neutrophils), and assessments of lung injury (tissue architecture and cell infiltration) were similar in the P2Y1-null and wild-type mice. I conclude that lung injury during LPS-induced inflammation in mice is independent of P2Y1 signaling. PMID:27815804
  4. In P2Y12(-/-) mice, the growth of syngeneic ovarian cancer tumors was reduced by >85% compared with wild-type (WT) mice. In contrast, there was no difference in tumor growth between P2Y1(-/-) and WT mice. PMID:28679740
  5. Mesenteric endothelial cells are primed by schistosomiasis to a pro-inflammatory phenotype characterized by an increased expression of NTPDases 2 and 3, favoring ADP accumulation and mononuclear cell adhesion, possibly contributing to mesenteric inflammation and schistosomiasis morbidity via P2Y1 receptor signaling. PMID:26924460
  6. the amounts of AChE activity, AChE catalytic subunit, structure subunit PRiMA and the amount of acetylcholine, in the brain were not, significantly, altered, suggesting the role of P2Y1R in neuron could have different function as that in muscle. PMID:27378627
  7. In P2Y1R (-/-) mice, the expression of P2Y2 receptor in muscle was reduced by over 50 %, as compared to P2Y1R (+/+) mice. P2Y1 receptor regulated the neuromuscular junction gene expression. PMID:26036470
  8. Our current results suggest that P2Y1 modulates heat responsiveness and chemosensation in muscle afferents to play a key role in the development of pain-related behaviors during ischemia. PMID:26740646
  9. Antibody EL2Ab binds to and exhibits P2Y1R-dependent function-blocking activity in the context of platelets. PMID:25593131
  10. P2Y1 couples to and activates TRPV4. PKC inhibitors prevented P2Y1 receptor activation of TRPV4. PMID:26475857
  11. The results of this study indicated that activation of the P2Y1R stimulates fibre growth and thereby emphasises the general role of this particular receptor subtype during development and regeneration. PMID:25683778
  12. The analysis of single and double KO mice demonstrated that NTPDase2 and P2Y1 receptors are not required for murine eye formation PMID:25504514
  13. Data indicate that knock down of purinergic P2Y1 receptors inhibited directed migration in neurospheres. PMID:25096637
  14. In a mouse model of Alzheimer disease, astroglial network dysfunction is mediated by P2Y1 receptor signalling in reactive astrocytes. PMID:25406732
  15. P2Y1R-KO mice displayed reduced cell numbers in the ganglion cell and inner nuclear layers, ischemia induced apoptotic death of cells in all retinal layers. PMID:25077539
  16. This study shows that Up4A is a potent native agonist for P2Y1R and SK-channel activation in human and mouse colon. PMID:25341729
  17. RhoA signaling downstream of platelet P2Y, but not P2Y, represents a clear dichotomy in platelet activation during allergic inflammation versus hemostasis. PMID:25445826
  18. purines activate SK currents via mainly P2Y1 receptors in PDGFRalpha(+) cells PMID:24396055
  19. It involves in LPS-induced IL-6 production in Kupffer cells, leading to the liver inflammation. PMID:24849676
  20. P2Y(1)-purinoceptors are not involved in the OFF-pathway-specific signal transmission in cholinergic amacrine cells of the mouse retina. PMID:23907621
  21. The purinergic receptor P2Y1 mediates migration of neuroblasts within naturally occurring electric fields in the mouse brain. PMID:23328740
  22. Activation of P2Y1 receptors in the glomerulus can stimulate network activity in the olfactory bulb. PMID:22187118
  23. results demonstrate a crosstalk between two metabotropic and one ionotropic purinergic receptor that regulates cAMP levels through adenylate cyclase 5 and modulates axonal elongation triggered by neurotropic factors and the PI3K-Akt-GSK3 pathway PMID:22250198
  24. The results of this study suggested that 9acGD3 controls granule cell progenitor migration by influencing P2Y(1)R cellular distribution and function. PMID:22894715
  25. The current study demonstrates that P2Y1 deletion or antagonism significantly reduced venous thrombosis in mice, suggesting that P2Y1 receptors play a role in the pathogenesis of venous thrombosis PMID:22588534
  26. In P2Y(1)(-/-) mice, EFS responses were completely blocked by L-NNA. PMID:22371472
  27. Purinergic responses were abolished in P2ry1(-/-) mice. PMID:22371476
  28. Inflammation-induced enhanced expression of P2Y1 is required for normal heat sensitization of cutaneous nociceptor fibers. P2Y1 plays a role in the maintenance of phenotype in cutaneous afferent fibers. PMID:22137295
  29. Purinergic signaling promotes the proliferation of rapidly dividing cells and transit-amplifying cells in the subventricular zone niche through the P2Y1 receptor. PMID:22764232
  30. Activation of P2Y1 and P2Y2 receptors induces chloride secretion via calcium-activated chloride channels in kidney inner medullary collecting duct cells. PMID:21653634
  31. The endothelial P2Yreceptor plays a key role in acute vascular inflammation and leukocyte recruitment in apoliproptein E-deficient mice. PMID:21576651
  32. Purinergic receptor P2RY1 stimulation reduces cytotoxic edema and brain infarcts in mouse induced by photothrombosis by energizing glial mitochondria PMID:21203502
  33. analysis of a novel Gi, P2Y-independent signaling pathway mediating Akt phosphorylation in response to thrombin receptors PMID:20586915
  34. results demonstrate a role for the P2Y1 receptor in both arterial and venous thrombosis; combination of P2Y1 deficiency with P2Y12 inhibition led to a significant additive effect in reducing thrombosis PMID:12871312
  35. In P2Y1-deficient mice, the ability of collagen to enhance the generation of thrombin was impaired PMID:12969982
  36. Reduced expression of P2Y1 receptors in neural progenitor cells lacking connexin43 affects calcium signaling and cell migration. PMID:14673009
  37. Inhibition of P2Y(1) alone prolonged the lag phase preceding aggregation in response to low or high concentrations of fibrillar collagen, without affecting the maximum amplitude of aggregation or secretion. PMID:15140133
  38. sequential expression of the P2X5, P2Y1, and P2X2 receptors during the process of muscle regeneration PMID:15231720
  39. the voltage dependence to Ca2+ release via Galphaq-coupled receptors is not due to control of G-proteins or down-stream signals but, rather, can be explained by a voltage sensitivity at the level of the P2Y1 receptor itself PMID:15528188
  40. In hippocampal slices, ATP activates P2Y1 receptors in the interneurons, which is linked to activation of unidentified excitatory conductance, through mechanisms distinct from those in the astrocytes. PMID:15574734
  41. ADP alone, used as a primary agonist, activated Rac and its effector PAK via its P2Y1 receptor, through a G(q)-dependent pathway and independently of P2Y12 PMID:16194206
  42. Induction of the osmolyte permeability in Plasmodium-infected erythrocytes involves autocrine purinoceptor signaling. PMID:16267125
  43. analysis of the coupling of purinergic P2Y1R to glutamate exocytosis and its peculiar TNFalpha- and PG-dependent control PMID:16882655
  44. examined calcium mobilization in platelets from mice that were either wild-type or homozygous null for PAR-4 or P2Y1 receptors, hypothesizing that the loss of PAR-4 or P2Y1 receptors would cause redistribution of its Galphaq proteins to other receptors PMID:16973501
  45. Loss of P2Y1 receptor function safeguards against capillary loss, fibrosis, and death by renal failure during experimental crescentic glomerulonephritis. PMID:17215444
  46. ATP released by nerve stimulation activates P2Y1 receptors, located prejunctionally, limiting its release by motoneurons PMID:17997228
  47. The P2Y(1) receptor contributes to atherosclerosis, primarily through its role in non-hematopoietic-derived cells. PMID:18663083
  48. Findings support a potential role for P2Y1Rs in regulation of vasopressin and oxytocin release in supraoptic nucleus neurons. PMID:19515986

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products