MEGTPAANWSIELDLGSGVPPGAEGNLTAGPPRRNEALARVEVAVLCLILFLALSGNACV LLALRTTRHKHSRLFFFMKHLSIADLVVAVFQVLPQLLWDITFRFYGPDLLCRLVKYLQV VGMFASTYLLLLMSLDRCLAICQPLRSLRRRTDRLAVLATWLGCLVASVPQVHIFSLREV ADGVFDCWAVFIQPWGPKAYVTWITLAVYIVPVIVLAACYGLISFKIWQNLRLKTAAAAA AAEGSDAAGGAGRAALARVSSVKLISKAKIRTVKMTFIIVLAFIVCWTPFFFVQMWSVWD VNAPKEASAFIIAMLLASLNSCCNPWIYMLFTGHLFHELVQRFLCCSARYLKGSRPGETS ISKKSNSSTFVLSRCSSSQRSCSQPSSA
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Receptor for oxytocin. The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system.
Gene References into Functions
Repression of OXTR signaling acutely modulates social interaction and sensory response profiles.PMID:29231812
Results show that OTR activation might constitute one of the neural substrate that is involved involved in the facilitative mechanisms to restore the sexual olfactory preferences of sexually naive Tph2-/- female mice.PMID:29470551
depressive-like behavior alters oxytocin receptor (OxtR) and arginine vasopressin receptor type 1a (AvpR1a) gene expression in the hippocampus (HC) of male mice.PMID:27525673
Chemogenetic activation of Oxtr(PBN) neurons robustly suppressed noncaloric fluid intake, but did not decrease food intake after fasting or salt intakePMID:29184212
Binding activity of OXTR in neonatal mice.PMID:28235051
Findings suggest that OXTR is an acute-phase protein and that its increased expression is regulated by NF-kappaB and functions to attenuate cellular inflammatory responses in macrophages.PMID:28049625
Results provide evidence that the oxytocin system contributes to the regulation of ethanol drinking and sensitivity and position OxtR as a central molecular mediator of ethanol's effects within the mesolimbic system, suggest that OxtR manipulation may be a relevant strategy to address ethanol use disorders.PMID:27306084
Data suggest that the study might contribute to the monosynaptic analysis of neuronal circuits and to the optogenetic analysis of neurons expressing oxytocin receptor (OXTR).PMID:26442453
Our results suggest that microglial abnormality is a potential mechanism of the development of Oxt/Oxtr mediated ASD-like phenotypes.PMID:26926566
The results suggest that oxytocin receptor is required for conditioned effects of an ethanol-associated social stimulusPMID:26282397
This study identify highly specialized roles of lateral septal mGluR5 and Oxtr in the the regulation of discrete social behaviors, and suggest that deficits in social interactions.PMID:25824423
OTR-null residents exhibited greater aggression toward intruders of the same strain compared to OTR wild-type or heterozygous residentsPMID:24929102
Oxtr signaling is crucial for entrainment of odor to social cues but is dispensable for entrainment to nonsocial cues. Oxytocin conveys saliency of social stimuli to sensory representations in the piriform cortex during odor-driven social learning.PMID:26139372
Study used the oxytocin analog Carbetocin and nucleus accumbens viral-mediated overexpression to assess the role of OxtR in the acquisition, extinction, and reinstatement of ethanol-induced conditioned place preferencePMID:25449413
Oxytocin's effect on osteoblast differentiation is mediated by and dependent on the internalization of Oxtrs and their translocation to the nucleus, facilitated by successive interactions with beta-arrestins, Rab5, Kpnb1), and Tnpo1.PMID:25378700
Silencing of interneurons that express the oxytocin receptor in the medial prefrontal cortex (mPFC) of female mice resulted in loss of social interest in male mice specifically during the sexually receptive phase of the estrous cycle.PMID:25303526
Impairments in the initiation of maternal behavior in oxytocin receptor knockout micePMID:24892749
Oxytocin elicits satiety through both central and peripheral oxytocin receptors.PMID:24877632
Collectively, our results suggest that brain region-specific expression of the mouse Oxtr gene is epigenetically regulated by DNA methylation of its promoter.PMID:24275011
Early interactions with mother and peers independently build adult social skills and shape BDNF and oxytocin receptor brain levelsPMID:22910688
This study is the first to demonstrate that the central oxytocin/oxytocin receptor system plays important roles in the regulation of body temperature homeostasis.PMID:24002032
This study demonistrated that Fear-enhancing effects of septal oxytocin receptors.PMID:23872596
The Oxtr(+/-) mouse is a unique animal model for investigating how partial loss of the Oxtr gene impair social interactions.PMID:22967062
LPS increased COX-2, connexin 43, and oxytocin receptor expression in uterus.PMID:22676250
It was shown that male aggression is heightened in oxytocin receptor -/- mice, and that differential activation in the medial amygdala, and possibly the lateral septum, may be contributing to the heightened aggression.PMID:22609339
the profile for Oxtr KO mice, including consistent social deficits, and reduced levels of communication, models multiple components of the autism spectrum disorders phenotypePMID:22100185
We consider the processes by which experience can affect oxytocin receptor binding, and what is known about the directionality of experience effects on oxytocin receptors--REVIEWPMID:22245313
we do find evidence for the role of OTR in predicting maternal behavior in micePMID:22300676
Mice that have Oxt receptor loss restricted to the forebrain that begins postweaning have a reduction in freezing behavior during acquisition, as well as during context and cue retention.PMID:21668734
Results suggest that variations of estrogen alpha/beta receptor levels are associated with differences in social interaction through the OT and AVP systems, by upregulating gene expression for those peptides and the oxytocin and vasopressin 1a receptors.PMID:21749489
investigation of regulation of ghrelin secretion in the MGN3-1 cell line: evidence that oxytocin and oxytocin receptors are involvedPMID:21521750
beta-arrestin is a multifunctional scaffold protein that mediates both desensitization of the OXTR, leading to decreases in uterine contractilityPMID:21139074
Inflammatory cytokines modulate the expression of functional oxytocin receptors in airway smooth muscle.PMID:20670427
results show that in mast cells ovarian hormones modulate OTR but not serotonin transporter(SERT) expression; oxytocin action on 5HT uptake depends on OTRs expressed; signaling between OTR and the SERT is mediated through activation of protein kinase C.PMID:12374464
Increases in myometrial oxytocin receptor and estrogen receptor alpha expression in late pregnant relaxin+/+ mice were attenuated in relaxin-/- mice. Probably mediated via activation of estrogen receptor-alpha.PMID:12959965
the present study has identified novel sites of oxytocin receptor expression in the mouse brain, suggesting additional functions of the oxytocinergic systemPMID:14596857
These results suggest that oxytocin (OT)-induced uterine contraction is not regulated solely by the quantity of OT receptors in the non-pregnant mouse uterus.PMID:15358162
Myometrial OTRs were significantly decreased on gestation day 18.5 in relaxin (Rlx)-/- mice than in Rlx+/+ micePMID:15956692
OXTR plays a critical role in regulating several aspects of social behavior, including aggression in males and maternal nurturing in femalesPMID:16249339
Oxytocin receptor-deficient mice developed late-onset obesity in mice.PMID:18520999
An investigation of various behaviours, most notably social recognition, in both oxytocin receptor containing and oxytoxin receptor knockout mice.PMID:18655873
ORE deficient mice display several aberrations in social behaviours, including male aggression, and mother-offspring interaction.PMID:18655874
Oxytocin may regulate serotonin release and exert anxiolytic effects via direct activation of oxytocin receptor expressed in serotonergic neurons of the raphe nuclei.PMID:19228979
We hypothesize that the Oxtr is involved in 'fine' intrastrain recognition, but is less important in 'broad' interstrain recognition.PMID:19531157