MSVRPFESPPPYRPDEFKPNHYAPSNDMYGGEMHVRPMLSQPAYSFYPEDEILHFYKWTS PPGVIRILSMLIIVMCIAIFACVASTLAWDRGYGTGLFGGSLNYPYSGFGYGGGYGGGYG GYGYGYGGYTDPRAAKGFLLAMAAFCFIASLVIFVTSVIRSGMSRTRRYYLIVIIVSAIL GIMVFIATIVYIMGVNPTAQASGSMYGSQIYMICNQFYTPGGTGLYVDQYLYHYCVVDPQ EAIAIVLGFMIIVAFALIIFFAVKTRRKMDRYDKSNILWDKEHIYDEQPPNVEEWVKNVS AGTQDMPPPPSDYAERVDSPMAYSSNGKVNGKRSYPESFYKSTPLVPEVAQEIPLTLSVD DFRQPRYSSNGNLETPSKRAPTKGKAGKGKRTDPDHYETDYTTGGESCEELEEDWVREYP PITSDQQRQLYKRNFDAGLQEYKSLQAELDDVNKELSRLDKELDDYREESEEYMAAADEY NRLKQVKGSADYKSKRNYCKQLKSKLSHIKRMVGDYDRRKP
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
May play a role in the formation and regulation of the tight junction (TJ) paracellular permeability barrier.
Gene References into Functions
PLD2 is pivotal in the regulation of the integrity of epithelial tight junctions and occludin turn over, thereby implicating it in the pathogenesis of colitis.PMID:28484281
Adherens as well as tight junction marker proteins were rapidly and consistently upregulated in both the germinal as well as the functional layer of the oral mucosa. This represents a previously unknown parameter of the epithelial radiation response to clinically relevant fractionation protocols. CONCLUSION: Fractionated irradiation significantly enhanced the expression of all proteins investigated. This study revealed aPMID:29675597
The C-terminal DSP domain induced phosphorylation of occludin Ser(490) and focal adhesion kinase (FAK) Ser(722) and Tyr(576). Coexpression of DSP, occludin and FAK was detected in dental mesenchymal cells during tooth development. Occludin physically interacts with FAK, and occludin and FAK phosphorylation can be blocked by DSP and occludin antibodies.PMID:28331230
Endothelial cellsTLR4 strongly regulates retinal vessel permeability by reducing expression of occludin and zonula occludens 1.PMID:29136627
The zinc sensing receptor, ZnR/GPR39, triggers intracellular Ca(2+) signalling in colonocytes thereby inducing occludin expression. Moreover, ZnR/GPR39 is essential for epithelial barrier recovery in the dextran sodium sulfate (DSS) ulcerative colitis model.PMID:27377730
Occludin expression by epidermal gammadelta T cells upon activation in response to epidermal stress allows them to move, which could be important for augmentation of immune responses via collaboration with other cells.PMID:28566372
Intracellular zinc has an essential role in the maintenance of the intestinal epithelial tight junction barrier through regulation of occludin proteolysis and claudin-3 transcription.PMID:27151944
miR-429 could down-regulate the expression of Ocln by targeting the Ocln 3'-UTR, which impaired intestinal barrier function in diabetes mellitus mice.PMID:27299781
STAT3 activation downregulates the ZO-1 and occludin levels and increases the endothelial permeability through the induction of VEGF production in retinal endothelial cells.PMID:27580405
Tricellulin is a specific redox sensor and sealing element at 3-cell contacts and may compensate as a redox mediator for occludin loss at 2-cell contacts in vivo and in vitro.PMID:25919114
These findings provide evidence for occludin playing a role in the invasion of Toxoplasma gondii in small intestinal epithelial cells.PMID:26183539
occludin deficiency increases susceptibility to ethanol-induced colonic mucosal barrier dysfunction and liver damage in mice.PMID:26721332
PHD3 protects intestinal epithelial barrier function and reveal a hydroxylase-independent function of PHD3 in stabilizing occludinPMID:26124271
Zonula occludens-1, occludin and E-cadherin expression and organization in salivary glandsPMID:25248927
Our study demonstrates spatiotemporal alterations in occludin mRNA- and protein-expression, indicating that Cx43 might act as a regulator for blood-testis-barrierPMID:24497041
Occludin and Claudin-1 expressions in the large intestine are under the circadian control, which is associated with temporal regulation of colonic permeability and also susceptibility to colitis.PMID:24845399
Hypoxic induction of CAV1 in the colon was essential for intestinal barrier integrity by regulating occludin expression.PMID:24891620
Activation of RhoA/ROCK1 by high glucose in diabetic nephropathy disrupts the expression and translocation of occludin/ZO-1, which can be corrected by simvastatin.PMID:24244596
Similar levels of occludin gene expression were detected.PMID:23568966
actin cytoskeletal dynamics is detrimental to METH-induced BBB dysfunction by increasing internalization of occludin.PMID:24081143
Occludin showed identical mRNA expression levels in the brains of adult and aged mice.PMID:22120415
occludin KO gammadelta T cells are defective in both initial accumulation and migration within the intraepithelial compartmentPMID:22511722
show that murine OCLN can sustain HCVcc entry, albeit with about 5-fold reduced efficiency compared to that of human OCLNPMID:21632765
Suggest occludin plays a crucial role in the maintenance of tight junction barrier through the large-channel TJ pathway, the pathway responsible for the macromolecule flux.PMID:21415414
The distribution patterns of tight junctions in ameloblasts by observing the expression patterns of OLD and CLDs (CLD-1 to CLD-10), were examined.PMID:20683698
The tight junction protein occludin (encoded by the OCLN gene) is involved in the pathogenesis of malformations of cortical development.PMID:20727516
Nedd4-2 interacts with occludin to inhibit tight junction assembly and the regulation of paracellular conductance in the collecting duct.PMID:20504882
marvelD3, occludin, and tricellulin define the tight junction-associated MARVEL protein familyPMID:20164257
in vivo imaging and transgenic mice expressing fluorescent-tagged occludin and ZO-1 fusion proteins to link occludin endocytosis to TNF-induced tight junction regulation.PMID:20351069
suggest that occludin has a protective as well as a barrier forming role in epithelia.PMID:20003227
Surface plasmon resonance study of interaction of occludin with ZO-1PMID:11700038
E-cadherin and claudins/occludin have roles in the regulation of tight junctions during the epithelium-mesenchyme transition, but are repressed by snailPMID:12668723
Data show that occludin is involved in establishing the blastocoel, in maintaining its impermeability, and that the development of tight junctions is critical for trophectoderm formation in mouse embryos.PMID:15179038
common molecular mechanism of forming a helical bundle between the hinge region/GuK domain of ZO-1 and alpha-catenin and occludin is identified as a general molecular principle organizing the association of ZO-1 at adherens and tight junctionsPMID:15548514
Loss of occludin expression is at least partially involved in the senescence-escape program during mammary tumorigenesis.PMID:17459053
Amyotrophic lateral sclerosis-linked superoxide dismutase 1 (SOD1) mutants with different biochemical characteristics disrupted the blood-spinal cord barrier in mice by reducing the levels of the tight junction protein occludin.PMID:18344992
Describe method to study the intracellular transport of occludin to and from the cell surface in both fibroblasts and epithelial cells.PMID:18369939
In mouse cerebral cortex, microinjection of VEGF-A disrupted CLN-5 and OCLN and induced loss of barrier functionPMID:19174516
the pro-inflammatory chemokine CCL2 mediates brain endothelial barrier disruption during CNS inflammationPMID:19423710
The oligomerization of the coiled coil-domain of occluddin is redox sensitivePMID:19538283
Disruptions of occludin and claudin-5 in brain endothelial cells in vitro and in brains of mice with acute liver failure.PMID:19821483
Localized at tight junctions of both epithelial and endothelial cells. Highly expressed in the testis, kidney, lung, liver and brain. Not detected in skeletal muscle, spleen and heart.