Recombinant Mouse Neuropeptide Y receptor type 2 (Npy2r)

Code: CSB-CF016036MO
Size:
20μg
20μg100μg
US$5375
Quantity:
Express system: in vitro E.coli expression system
Species: Mus musculus (Mouse)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
Npy2r
Uniprot NO.
Alternative Names
Npy2r; Neuropeptide Y receptor type 2; NPY2-R; NPY-Y2 receptor; Y2 receptor
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
1-385
Target Protein Sequence
MVLKMGPVGAEADENQTVEVKVEPYGPGHTTPRGELPPDPEPELIDSTKLVEVQVILILA YCSIILLGVVGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEW KMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGIS ALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSVYGTVYSLSTLLILYVLPLGIIS FSYTRIWSKLRNHVSPGAASDHYHQRRHKMTKMLVCVVVVFAVSWLPLHAFQLAVDIDSH VLDLKEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSMT FKAKKNLEVKKNNGPTDSFSEATNV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Receptor for neuropeptide Y and peptide YY.
Gene References into Functions
  1. High Npy2r expression is associated with chronic social defeat stress. PMID:30201296
  2. These results indicate that endogenous PYY has a hypoalgesic effect on somatic thermal and visceral chemical pain. The effect on visceral pain seems to be mediated by peripheral Y2 receptors. PMID:28106168
  3. NPY and agonists of Y2R and Y5R may be neuroprotective against oxygen-glucose deprivation-induced neuronal cell death in primary cortical cell cultures after delayed treatment. A Y2R agonist not only diminished transient cerebral ischemia-induced neuronal injury, but also improved functional outcome after delayed treatment. Y5 and especially Y2 receptors may be promising targets for neuroprotection against ischemic damage PMID:28057538
  4. Findings suggest that neuropeptide Y is expressed by distinct populations of neurons can modulate afferent and efferent projections of the central amygdala via presynaptic Y2 receptors located at inhibitory and excitatory synapses. PMID:26365505
  5. confirms the critical role of Y2 signalling to control neuropeptide Y and associated pro-opiomelanocortin expression in the arcuate nuclei PMID:26444586
  6. Study shows that NPY inhibits fear learning and promotes cued extinction by reducing fear expression also via activation of presynaptic Y2 receptors on central amygdala neurons PMID:26314208
  7. Our results showed the altered expression of NPY, Y1R and Y2R but not Y5R in hippocampus and temporal lobe cortex of tremor rat brain. PMID:24444822
  8. Data from knockout (KO) mice suggest roles for neuropeptide Y (NPY) and NPY2 receptors in fear acquisition/fear stimulus discrimination. Npy1r/Npy2r double KO mice display excessive recall of conditioned fear/impaired fear extinction. PMID:22289084
  9. NPY Y2 receptors control the level of hyperactive behavior under conditions of limited food access. PMID:21923762
  10. Peripheral Y2 receptor signaling is critical in the regulation of oxidative fuel selection and physical activity and protects against high-fat diet-induced obesity. PMID:21546930
  11. NPY-Y2 receptor exerts a direct control over both the tonic and phasic release of dopamine PMID:21055451
  12. Data describe the complex interaction between Y2/Y4 receptors in control of bone mass, and suggest that the reduction in cortical bone observed in the absence of leptin is due to the anti-osteogenic effect of elevated hypothalamic NPY levels. PMID:20635164
  13. Data from studies in knockout mice suggest that signaling through Y2 receptor prevents development of long-term anxiety-/depression-like behaviour caused by acute immune challenge. Study includes comparison with Y4 receptor knockout mice. PMID:19939871
  14. Taken together, this work demonstrates the critical roles of Y2 and Y4 receptors in the regulation of body composition and energy metabolism, highlighting dual antagonism of Y2 and Y4 receptors as a potentially effective anti-obesity treatment. PMID:20881101
  15. PYY/PYY(3-36) potently inhibits basal and stress/serotonin/cholinergic-stimulated propulsive colonic motor function in conscious mice, likely via Y(2) receptors PMID:19892938
  16. data reveal an anti-osteogenic effect of Y2 receptors on hypothalamic NPY-expressing neurons on trabecular but not on cortical bone PMID:20613867
  17. In Y2 knockout mice motor activity in the antrum was more affected than that in the duodenum, and both fed and fasted motor activities were affected in the antrum. PMID:20501433
  18. Results indicate that NPY Y2 receptor agonists inhibit diarrhea in mice by not only reducing intestinal fluid secretion, but also slowing colonic transit. PMID:19925840
  19. results are evidence of the highly site-specific nature of the Y2-mediated function of NPY in the modulation of anxiety- and depression-related behavior. PMID:20445054
  20. Y2 depletion influences a range of behaviours, which are potentially relevant for schizophrenia-related research PMID:19879900
  21. These findings attest to a differential role of Y2 and Y4 receptor signalling in the circadian control of behaviours that balance energy intake and energy expenditure. PMID:19781771
  22. Role of neuropeptide Y Y(2) receptors in modulation of cardiac parasympathetic neurotransmission PMID:11786149
  23. hypothalamic Y2 receptors are involved in a tonic inhibition of bone formation. PMID:11927618
  24. role in body weight regulation PMID:12072562
  25. Y2 receptor participates in cholesterol and glucose homeostasis of obese mice PMID:12126735
  26. PYY(3-36) inhibits food intake in mice but not in Y2r-null mice, which suggests that the anorectic effect requires the Y2R PMID:12167864
  27. Deletion of this receptor results in blockage of NPY-induced angiogenesis and delayed wound healing. PMID:12730369
  28. NPY Y(2) receptors may play an inhibitory role and supports the hypothesis that Y(2) receptors are involved in the regulation of anxiety-like behaviours by NPY PMID:12742262
  29. tonic activation of submucosal Y(2) receptors could indirectly reduce mucosal ion transport in the colon, while direct activation of Y(2) receptors on longitudinal muscle results in contraction PMID:12813010
  30. deletion of the Y2 receptor has revealed an important role of Y2 receptors in the generation of anxiety-related and stress-related behaviours in mice PMID:12859347
  31. Y2 and Y4 receptors have roles in adiposity and bone mass PMID:12861009
  32. High levels of NPY-Y2R expression in the preoptic nuclei suggest involvement of Y2R in the regulation of reproductive behavior, whereas Y2R expression in arcuate, dorsomedial, and perifornical nuclei may be relevant to feeding and body weight control. PMID:14755515
  33. NPY Y2-/- mice displayed a deficit on the probe trial in the Morris water maze task, and exhibited marked deterioration in object memory 6 h, but not 1 h, following initial exposure in the object recognition test PMID:14997009
  34. Results provide strong evidence for the role of the Y2 receptor mediating neuropeptide Y subjective day phase-advance shifts in mice. PMID:15619538
  35. Taken together, these data suggest that, in mice, both Y2 and Y5 receptors regulate hippocampal seizures in vitro, while activation of Y5 receptors in extra-hippocampal regions reduces generalized seizures in vivo. PMID:15979311
  36. These results demonstrate that the NPY Y2R is associated mainly with both peptidergic and nonpeptidergic small, presumably nociceptive, neurons projecting to the superficial layers of the dorsal horn. PMID:16025447
  37. A role is indicated for NPY-Y2 receptors in the accumulation of adipose tissue in the hypogonadal state; hypothalamic Y2 receptors constitutively restrain osteoblastic activity even in the absence of sex hormones. PMID:16785231
  38. The Y2-mediated anabolic pathway stimulates cortical and cancellous bone formation. PMID:16995815
  39. The widespread distribution of Y2R-positive cell bodies and fibers suggests that NPY signaling through the Y2R is common in the mouse brain. PMID:16998904
  40. Release of NPY tonically inhibits synaptic transmission in mice and its effects are mediated by Y2 receptor activation. However, both NPY and BIIE0246 were much less effective in mice than in rats. PMID:17027162
  41. fasting inhibits the somatotropic axis via direct action on Y2 receptors in the Arcuate nucleus and indirectly inhibits the gonadotropic axis via Y4 receptors. PMID:17272395
  42. Diet-induced obese mice had low plasma PYY, which may have caused compensatory up-regulation of PYY and Y2 receptor densities in medulla. PMID:17615145
  43. activation of neurons in the nucleus of the solitary tract following administration of T2R agonists to the GI tract involves CCK(1) and Y(2) receptors located on vagal afferent terminals in the gut wall PMID:18003792
  44. Data show that the replacement of a high-fat diet with a low-fat diet was associated with a significant lowering of ventromedial hypothalamic neuropeptide Y Y2 receptor binding, and also a lowered plasma PYY level. PMID:18357520
  45. Mice lacking Y2 receptors exhibited reduced neuronal activation when compared to WT animals in response to the emotional stressors. PMID:19084906
  46. critical role for neuropeptide Y/neuropeptide Y2 receptor interactions in adipogenesis PMID:19182605

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links

UNIGENE: Mm.1433

KEGG: mmu:18167

STRING: 10090.ENSMUSP00000096595

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products