MNSTLFSKVENHSIHYNASENSPLLAFENDDCHLPLAVIFTLALAYGAVIILGVSGNLAL IIIILKQKEMRNVTNILIVNLSFSDLLVAVMCLPFTFVYTLMDHWVFGETMCKLNPFVQC VSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYIGITVIWVLAVASSLPFVIYQILTD EPFQNVSLAAFKDKYVCFDKFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRR NNMMDKIRDSKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLL FLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSK TSLKQASPVAFKKISMNDNEKV
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
This study showed that the Npy1r(Y5R-/-) male mice display decreased 5-hydroxytriptamine (5-HT) positive fibres and increased baseline neural activity in orbitofrontal cortex.PMID:29353053
the lack of Y1Rs stimulates the formation of larger multinucleated osteoclasts in vitro with reduced bone-resorbing activity.PMID:27646989
Knockdown of the Y1 receptor induces alkaline phosphatase activity and mineralization of MC3T3-E1 cells.PMID:28656295
The vasoconstrictive mechanism has been identified as neuropeptide Y acting on Y1 receptors.PMID:27244241
findings suggest that reduced Y1R expression leads to a decrease in resting vagal modulation and heart rate variability, which, in turn, may determine a reduced cardiac autonomic responsiveness to acute stress challenges.PMID:27474416
conditional inactivation of Y1 receptors specifically in Y5 receptor containing neurons increases stress-related anxiety without affecting endocrine stress responses.PMID:26178014
Npy1r(Y5R-/-) mice show increased anxiety-related behavior but no changes in hypothalamus-pituitary-adrenocortical axis activity or in body weight growth, independently of gender and mouse strain used as foster mothers. Also, Npy1r(Y5R-/-) mice of both genders display increased spatial reference memory in the Morris water maze test.PMID:24548641
Study shows pronounced adaptive changes in the mouse hippocampus both with regard to NPY synthesis and NPY receptor synthesis and binding, which may contribute to regulating neuronal seizure susceptibility after kainatePMID:24985894
NPY and its Y receptor are possible mediators of both vasoconstriction and pulmonary vascular remodelling in pulmonary hypertensionPMID:24779394
an integrated neural circuit modulates growth hormone release relative to food intake; data provide essential information to address the differential roles of Y1 and Y2 receptors in regulating the release of GH under fed and fasting statesPMID:25471570
Regulation of neuropeptide Y Y1 receptor expression by bone morphogenetic protein 2 in C2C12 myoblastsPMID:24025680
These findings suggest that the global absence of the Y1 receptor delays fracture healing, through impairing the early phases of fracture repair to achieve bony union.PMID:23733357
Neuropeptide Y1 receptor in immune cells regulates inflammation and insulin resistance associated with diet-induced obesity.PMID:23011592
These studies demonstrate the pivotal, combined role of both Y1 and Y5 receptors in the mediation of food intake.PMID:22768253
Data from knockout (KO) mice suggest roles for neuropeptide Y (Npy) and Npy1 receptors in extinction of conditioned fear. Npy1r/Npy2r double KO mice display excessive recall of conditioned fear/impaired fear extinction.PMID:22289084
NPY Y1 receptor deficient mice lack the expression of appetitive behavior.PMID:21923762
study demonstrates that signalling through Y1-receptors emerges as a critical pathway for the development of airway inflammationPMID:21383768
In dentate gyrus proliferative effect of neuropeptide Y is mediated by the Y1 and not the Y2 receptor, as a Y1 ([Leu31,Pro34]), but not a Y2 (NPY3-36), receptor agonist enhanced neurogenesis.PMID:20095007
Fluctuations in circulating levels of gonadal hormones, depending on estrous cycle, are paralleled by changes in the expression of NPY Y1 receptor in the hypothalamic nuclei involved in the control of both energy balance and reproduction.PMID:21514339
Data show that Y2R is mostly presynaptic, coexists with NPY and NPY Y1R, and suggest that Y2Rs thus have a modulatory role in mediating presynaptic neurotransmitter release.PMID:21452195
These data demonstrate a direct role for the Y1 receptor on osteoblasts in the regulation of osteoblast activity and bone formation.PMID:21040809
findings attest to a role of Y1 receptor signalling in the control of stress coping and/or adaptationPMID:19351805
The NPY system, via the Y1 receptor, directly inhibits the differentiation of mesenchymal progenitor cells as well as the activity of mature osteoblasts.PMID:20200977
These data indicate that ATP initiates neuroproliferation via NPY upregulation, NPY release, and Y1 receptor activation, and suggests that the olfactory epithelium is good model to study neuroregenerative mechanisms in the CNS.PMID:20211262
The Y(1) receptor influences the acoustic startle response and its habituation but does not play a major role in sensorimotor gating.PMID:20096928
The NPY Y1 receptor regulates voluntary ethanol consumption and some of the intoxicating effects caused by administration of ethanolPMID:11826154
Expression of neuropeptide Y Y1 receptor gene is altered in medial amygdala of transgenic mice during pregnancy and after deliveryPMID:12358774
Reduction of NPY1 receptor gene expression in ventromedial nucleus. Significant increase in Y1R/LacZ transgene expression and NPY1 receptor mRNA were observed in arcuate nucleus of mice on 18th day of pregnancy.PMID:12960052
biological redundancies between Y1 and Y5 receptor signaling in the NPY-mediated control of food intake.PMID:14525913
The neuropeptide Y Y1 receptor mediates NPY-induced inhibition of the gonadotrope axis under food restriction conditions.PMID:14597564
These results suggest that neuropeptide Y acting through Y1 receptors regulates the serotonin system, thereby coordinately linking physiological survival mechanisms such as food intake with enabling territorial aggressive behavior.PMID:15314215
NPY Y1 KOs showed: reduced somatomotor activation ,lower heart rate,larger heart rate responsiveness during social defeat, increased number of alpha2-ARs in the dorsal motor nucleus of the vagus (nX) and the locus coeruleus (LC).PMID:15652259
Y1-R-specific hybridization was observed within the mouse hypothalamus. Y1-R mRNA expression was observed in MC4-R-positive cells in several brain sites such as the PVH and central nucleus of the amygdala.PMID:15690487
Compensatory changes in the expression of Y2-receptors occur in Y1-receptor-deficient mice. These adaptations are likely to contribute to changed physiological function.PMID:16198492
The important role of Y(1) receptors is the regulation of motor activity, exploration, and anxiety-related behaviours.PMID:16203045
The effects of single, double, or triple knockouts of the Y1, Y2, and Y4 receptors on the dietary effects of fat in mice are reported.PMID:16380472
NPY controls the release and synthesis of catecholamine from the adrenal medulla and consequently contributes to the sympathoadrenal tonePMID:16798884
Y1, Y2, and Y4 receptors are not crucially involved in NPY's hyperphagic, hypogonadal, and obesogenic effects, but they are responsible for the central regulation of circulating insulin levels by NPY.PMID:16873543
The Y1 receptor has a major role in neural tube closure. The teratogenic effect of PYY is exerted at the biologically active dose and involves a specific mechanism mediated by the Y1 receptor.PMID:17400914
Y1 receptor pathways act powerfully to inhibit bone production and adiposity by nonhypothalamic pathways, with potentially direct effects on bone tissue through a single pathway with Y2 receptorsPMID:17491016
greater number of mesenchymal progenitors and the altered Y1 receptor expression within bone cells in the absence of Y2 receptors are a likely mechanism for the greater bone mineralizationPMID:17491022
Transgenic NPY(1)R/LacZ FVB mice show a sexual dimorphism both on energy intake and on nucleus-specific regulation of the NPY Y(1)R system in the hypothalamus.PMID:17584829
these data provide a detailed and comparative mapping of Y(1) and Y(5) receptor promoter activity within cells of the mouse brainPMID:17614946
In mouse chromaffin cells, NPY evokes catecholamine release by the activation the NPY Y1 receptor, in a Ca2+-dependent manner, by activating mapK and nitric oxide production.PMID:17868303
Y1R is necessary for the anxiolytic-like effects of icv NPY, but not for the antidepressant-like or neurogenesis-inducing effects of fluoxetine.PMID:17891380
Together these results indicate that NPY and the Y1 receptor are required for the normal proliferation of adult olfactory precursors and olfactory function.PMID:18088353
Mice deficient in Y1Rs or Y2Rs have fewer Ki-67-immunoreactive proliferating precursor cells and doublecortin-ir neuroblasts in the SVZ and RMS than WT mice, and less calbindin-, calretinin-, and tyrosine hydroxylase-ir interneurons in the OB.PMID:18305161
NPY may elicit TGF-beta1 production in RAW264.7 cells via Y1 receptor, and the activated PI3K pathway may account for this effect.PMID:18500388
Npy1r-deficient mice display elevated IgM and IgG1 antigen-specific antibody responsePMID:18802344
Chronically elevated NPY levels leaded to a modulation of the level of Y2 receptor expression and negative regulation of Y1 receptor expression.PMID:19459152
Show
More
Hide
All
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
The alpha form is highly expressed in the brain, heart, kidney, spleen, skeletal muscle, and lung, whereas the beta receptor mRNA was not detected in these tissues. However, the beta form is expressed in mouse embryonic developmental stage (7 and 11 days)