Recombinant Mouse Natural killer cells antigen CD94 (Klrd1)

Code: CSB-CF012470MO
Size:
20μg
20μg100μg
US$3834
Quantity:
Express system: in vitro E.coli expression system
Species: Mus musculus (Mouse)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
Klrd1
Uniprot NO.
Alternative Names
Klrd1; Cd94; Natural killer cells antigen CD94; Killer cell lectin-like receptor subfamily D member 1; CD antigen CD94
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
1-179
Target Protein Sequence
MAVSRITRWRLMSVIFGIKCLFLMVTLGVLLINSFTIQNIQSTPSPTTTVEFQEVSECCVCLDKWVGHQCNCYFISKEEKSWKRSRDFCASQNSSLLQPQSRNELSFMNFSQTFFWIGMHYSEKRNAWLWEDGTVPSKDLFPEFSVIRPEHCIVYSPSKSVSAESCENKNRYICKKLPI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Immune receptor involved in self-nonself discrimination. In complex with KLRC1 or KLRC2 on cytotoxic and regulatory lymphocyte subsets, recognizes non-classical major histocompatibility (MHC) class Ib molecule MHC-E loaded with self-peptides derived from the signal sequence of classical MHC class Ia and non-classical MHC class Ib molecules. Enables cytotoxic cells to monitor the expression of MHC class I molecules in healthy cells and to tolerate self. Primarily functions as a ligand binding subunit as it lacks the capacity to signal.; KLRD1-KLRC1 acts as an immune inhibitory receptor. Key inhibitory receptor on natural killer (NK) cells that regulates their activation and effector functions. Dominantly counteracts T cell receptor signaling on a subset of memory/effector CD8-positive T cells as part of an antigen-driven response to avoid autoimmunity. On intraepithelial CD8-positive gamma-delta regulatory T cells triggers TGFB1 secretion, which in turn limits the cytotoxic programming of intraepithelial CD8-positive alpha-beta T cells, distinguishing harmless from pathogenic antigens. In MHC-E-rich tumor microenvironment, acts as an immune inhibitory checkpoint and may contribute to progressive loss of effector functions of NK cells and tumor-specific T cells, a state known as cell exhaustion. Upon MHC-E-peptide binding, transmits intracellular signals through KLRC1 immunoreceptor tyrosine-based inhibition motifs (ITIMs) by recruiting INPP5D/SHIP-1 and INPPL1/SHIP-2 tyrosine phosphatases to ITIMs, and ultimately opposing signals transmitted by activating receptors through dephosphorylation of proximal signaling molecules.; KLRD1-KLRC2 acts as an immune activating receptor. On cytotoxic lymphocyte subsets recognizes MHC-E loaded with signal sequence-derived peptides from non-classical MHC class Ib MHC-G molecules, likely playing a role in the generation and effector functions of adaptive NK cells and in maternal-fetal tolerance during pregnancy. Regulates the effector functions of terminally differentiated cytotoxic lymphocyte subsets, and in particular may play a role in adaptive NK cell response to viral infection. Upon MHC-E-peptide binding, transmits intracellular signals via the adapter protein TYROBP/DAP12, triggering the phosphorylation of proximal signaling molecules and cell activation.
Gene References into Functions
  1. Segregation of a spontaneous Klrd1 mutation in DBA/2 mouse substrains PMID:25520036
  2. The transmembrane region sequences of CD94 and NKG2 in mouse and rat differ markedly from other mammalian orthologs by the presence of a lysine residue in the transmembrane region. PMID:22084441
  3. show that CD94, a molecule preferentially expressed by NK cells, is essential for the resistance of C57BL/6 mice to mousepox, a disease caused by the Orthopoxvirus ectromelia virus PMID:21439856
  4. CD94 and NKG2 were both expressed early in NK cell development, sometimes in the absence of NK1.1, with CD94 invariably being expressed at two different levels. IL-4 differentially inhibited the expression of CD94 and Ly49 receptors. PMID:11870631
  5. Inhibitory receptor CD94 is expressed on mature fetal thymic and adult epidermal TCR Vgamma3+ lymphocytes. PMID:11907085
  6. The acquisition of individual receptor gene expressions during various stages of differentiation in culture from embryonic stem cells to NK cells follows a predetermined order, with the order of receptor acquisition being first CD94. PMID:11994449
  7. There is no evidence that CD94 inhibits either the lytic function of lymphocytic choriomeningitis virus-specific T cells or their capacity to produce effector cytokines upon peptide stimulation. PMID:12097371
  8. The engagement of the activating isoforms of C-type lectin inhibitory receptor (CD94)by their natural ligands, represented by soluble HLA-I molecules, induced programmed cell death of natural killer cells PMID:12393468
  9. CD94 heterodimers costimulate effector functions of differentiated Th1 cells, but not Th2 cells. PMID:12421909
  10. A high level of expression of CD94/NKG2 receptors is correlated with a lower level of apoptosis and may play an important role in the maintenance of CD8 T and NK cells. PMID:12574337
  11. Identification of a novel second CD94 upstream CD94 promoter and the observation that various lymphoid cells use the two promoters differentially offer a theoretical mechanism for the expression of NK receptors on non-NK cells. PMID:14530345
  12. CD94-expressing anti-polyoma virus CD8 T cells appear to be essential for antigen-specific recall responses in mice persistently infected by polyoma virus. PMID:16670321
  13. CD94 is an Ag that can be used to identify functionally distinct NK cell subsets in mice and could also be relevant to late-stage mouse NK cell development. PMID:19801519

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type II membrane protein.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products