Recombinant Mouse NADPH oxidase 1 (Nox1)

Code: CSB-CF015959MO
Size:
20μg
20μg100μg
US$6917
Quantity:
Express system: in vitro E.coli expression system
Species: Mus musculus (Mouse)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
Nox1
Uniprot NO.
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
1-591
Target Protein Sequence
MAGELRGSRGPLQRIQIAPREAPNLHLTMGNWLVNHWLSVLFLVSWLGLNIFLFVYAFLN YEKSDKYYYTREILGTALALARASALCLNFNSMMILIPVCRNLLSFLRGTCSFCNRTLRK PLDHNLTFHKLVAYMICIFTVIHIIAHLFNFERYRRSQQAMDGSLASVLSSLSHPEKEDS WLNPIQSPNMTVMYAAFTSIAGLTGVIATVALVLMVTSAMEFIRRNYFELFWYTHHLFIV YIICLGIHGLGGIVRGQTEESLGESHPHNCSHSFHEWDDHKGSCRHPHFAGHPPESWKWI LAPIAFYIFERILRFYRSQQKVVITKVVMHPSNVLELQMRKRGFSMEVGQYIFVNCPSIS FLEWHPFTLTSAPEEEFFSVHIRAAGDWTRNLIRTFEQQHSPMPRIEVDGPFGTVSEDVF QYEVAVLVGAGIGVTPFASILKSIWYKFQRADNKLKTQKIYFYWICRETGAFAWFNNLLN SLEQEMEELGKMDFLNYRLFLTGWDSNIAGHAALNFDRATDILTGLKQKTSFGRPMWDNE FSRIATAHPKSAVGVFLCGPRTLAKSLRKRCQRYSSLDPRKVQFYFNKETF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Pyridine nucleotide-dependent oxidoreductase that generates superoxide and might conduct H(+) ions as part of its electron transport mechanism.
Gene References into Functions
  1. these data show a role for NOX1-produced reactive oxygen species in maintaining homeostasis of the gut microbiota PMID:29210363
  2. Its pathway may promote reactive oxygen species generation in the early stage of Alzheimer's disease and eventually contribute to the exacerbation of pathological phenotype. PMID:29602494
  3. NADPH oxidase-mediated redox signaling is important in the detrimental effect of C-reactive protein on pancreatic insulin secretion. PMID:28778482
  4. these data demonstrate that altered zinc distribution leading to accumulation of zinc in the mitochondria increases mitochondrial ROS production causing NF-kappaB activation which in turn upregulates Nox1 expression inducing senescence of vascular smooth muscle cells PMID:28363602
  5. our data identify EBP50 as a previously unidentified regulator of Nox1 and support that it promotes Nox1 activity by binding p47(phox) This interaction is pivotal for agonist-induced smooth muscle ROS, hypertrophy, and vasoconstriction and has implications for ROS-mediated physiological and pathophysiological processes. PMID:27540115
  6. We examined the pattern of NOX expression in spinal cords of patients and mouse models of ALS and analyzed the impact of genetic deletion of the NOX1 and 2 isoforms as well as pharmacological NOX inhibition in the SOD1(G93A) ALS mouse model.In contrast to previous publications, survival of SOD1(G93A) mice was not modified upon breeding with constitutive NOX1 and NOX2 deficient mice. PMID:27212019
  7. NOX-derived superoxide intesifies diabetogenic antiviral macrophage responses and protect from virus-induced diabetes PMID:29158420
  8. we used the Ang II infused hph-1 mice to examine the roles of NOX isoforms in the development of AAA. We generated double mutants of hph-1-NOX1, hph-1-NOX2, hph-1-p47phox, and hph-1-NOX4 PMID:27912196
  9. C-kit-positive hematopoietic stem/progenitor cells expressed significantly higher of Nox1 and catalase, but less of lactoperoxidase than in matured mononuclear cells. PMID:25451257
  10. Nox1 deletion reduces oxidant load and restores microvascular health in obese mice. PMID:28684629
  11. Data suggests that ROS produced during primitive endoderm differentiation is dependent in part on increased NOX1 and NOX4 levels, which is under the control of GATA6. Furthermore, these results suggest that the combined activity of multiple NOX proteins is necessary for the differentiation of F9 cells to primitive endoderm. PMID:28152080
  12. Gp91phox NADPH oxidase modulates litter size by up-regulating mucin1 expression in the uterus of mice. PMID:28301257
  13. 5-HT1B receptor-dependent cellular Src-related kinase-Nox1-pathways contribute to vascular remodeling in pulmonary arterial hypertension. PMID:28473438
  14. NOX4- and NOX1-derived ROS contribute to atherosclerosis in the aortic sinus of diabetic ApoE knockout mice. PMID:27190136
  15. Data show that pan-NOX-inhibitor APX-115 treatment decreased NADPH oxidase (Nox) Nox1, Nox2, and Nox4 protein expression in the kidney. PMID:28165467
  16. NOX1 is selectively important in GPCR-dependent intracellular ROS generation but dispensable for GPVI-ITAM-dependent ROS generation in blood platelets.. PMID:26988594
  17. Plasmid driven elevation of NOX-1 resulted in elevated ROSreactive oxygen species, loss of glucose-stimulated-insulin-secretion and increased apoptosis. These outcomes on beta cell function are analogous to cytokine treatment. PMID:28232183
  18. Nox1-knockout (Nox1-KO) mice were not more sensitive to S. Tm colonization and infection than WT B6 mice. PMID:28028364
  19. data provide direct evidence that NOX1 and NOX2 deficiency impairs macrophage differentiation PMID:27489105
  20. In a depressive disorder model, NOX1 is up-regulated only in ventral tegmental area but not in prefrontal cortex. PMID:28314819
  21. promotes colon mucosal wound repair by sustaining the bioactivity of crypt progenitor cells and plays a crucial role in the epithelial restitution in the case of damage associated with colitis. PMID:26876598
  22. p38 and NOX1 are essential for the protective effect of c-Myb and that NOX1 acts upstream of p38 activation. PMID:27107996
  23. The results suggested that radiationinduced pulmonary fibrosis may be efficiently reduced by specific inhibition of NOX1, an effect mediated by reduction of fibrotic changes of ECs. PMID:27053172
  24. data demonstrate that the PI3K p110alpha-Akt/Rac1 and NOX1 signalling pathways play a pivotal role in VEGF-induced vascular differentiation and cell migration. PMID:26553657
  25. Data show that caveolin 1 (CAV1) is required for transforming growth factor-beta (TGF-beta)-induced reactive oxygen species production, mediated by NADPH oxidase NOX1, that is necessary for a disintegrin and metalloproteinase 17 (ADAM17) activation. PMID:26815118
  26. Results indicate that NADPH oxidase 1 modulates the innate and adaptive cellular immune response to influenza virus infection, while also playing a role in host survival. PMID:26910342
  27. JNK suppresses the inflammatory response to TNF-alpha by reducing Nox1-dependent endosomal reactive oxygen species production. PMID:26001727
  28. BMP4 has a role in inducing NOX1-dependent eNOS uncoupling in T2DM, which may promote development of novel therapeutics restoring endothelial function in T2DM PMID:26121233
  29. NOX1 and NOX4 signaling mediates the pathogenesis of liver fibrosis, including the direct activation of HSC. PMID:26222337
  30. Nox1 may have a protective effect against hypoxia-induced sinoatrial node dysfunction. PMID:25837936
  31. NOX1-mediated chemoresistance is related with the reactive oxygen species/HIF-1alpha/MDR1 pathway. PMID:26545779
  32. These findings support the central role played by NOX-ROS in the pathogenic cascade leading to muscular dystrophy and suggest diapocynin as an effective NOX inhibitor that might be helpful for future therapeutic approaches. PMID:25329652
  33. Established are novel molecular mechanisms underlying oxidative stress-mediated dopaminergic neuronal death in which MMP3 activation is a key upstream event that leads to Nox1 induction and eventual dopaminergic neuronal death. PMID:25536219
  34. Early, but not late, postnatal hyperoxia results in induction of NOX1 expression that is mitochondrial reactive oxygen species dependent. PMID:26092998
  35. Local activity of NADPH oxidase differentially modulates responses to ET-1 with aging in distinct vascular beds. PMID:24382462
  36. Data suggest that the key interactions might be valuable to discover and screen apocynin analogues as potent inhibitors of NADPH oxidase. PMID:23344042
  37. Weakly positive reactions with Nox1, Noxa1, and Noxo1 were observed in the zones of proliferative and prehypertrophic chondrocytes at 3 weeks of age PMID:25152242
  38. NOX induces macrophage autophagy by producing reactive oxygen species in Aspergillus fumigatus infection. PMID:25652860
  39. Data reveal that both Nox1 and Nox2 were involved in collagen-mediated thrombus formation at arterial shear and indicate a major role for Nox1 in GPVI-dependent ROS production, which regulates TxA2 generation via a p38-dependent signaling pathway. PMID:24494191
  40. Nox1 threonine 429 phosphorylation facilitated association of Nox1 with NoxA1 activation domain. PMID:25228390
  41. Schistosoma japonicum infection causes upregulation of cannabinoid receptor-1 and NADPH oxidase leading to fibrotic activation of mouse hepatic stellate cells. PMID:24657416
  42. Our findings suggest that strategies targeting NOX1 have the potential to be effective treatments for a range of ischemic retinopathies PMID:24053718
  43. identify a critical role for Nox1 in late ischaemic preconditioning and define a previously unrecognized link between TNF-alpha and NF-kappaB in mediating tolerance to myocardial injury PMID:24501329
  44. these data identify the two specific sites of N-linked glycosylation of murine NOX1 and demonstrate that they are not required for normal enzyme activity, protein stability, and membrane trafficking PMID:24361341
  45. we propose that ileocolitis in the GPx1/2-double-knockout mice is caused by Nox1, which is induced by TNF. PMID:24374371
  46. NOX1 is involved in acure respiratory distress syndrome pathophysiology and is responsible for the damage occurring in alveolar epithelial cells at least in part via STAT3 signalling pathways. PMID:24551274
  47. Data indicate that urotensin II (UII) increased reactive oxygen species production by NADPH oxidase. PMID:24116164
  48. gp91(phox-/-) mice appear to be completely protected from dopaminergic cell loss. PMID:24379900
  49. Following 30min of ischemia and 24h of reperfusion, a significant decrease in the size of myocardial infarct was observed in Nox1-, Nox2- and Nox1/Nox2-, but not in Nox4-deficient mice. PMID:24051369
  50. Data show that gp91(phox)-containing NADPH oxidase activity in macrophages and neutrophils was essential for optimal bacterial clearance during respiratory Methicillin-resistant Staphylococcus aureus (MRSA) infections. PMID:24563256

Show More

Hide All

Subcellular Location
Cell projection, invadopodium membrane; Multi-pass membrane protein. Cell membrane.
Tissue Specificity
[Isoform 2]: Expressed in colon and vascular smooth muscle cells (VSMC).
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products