MANFTPVNGSSANQSVRLVTTAHNHLETVEMVFIATVTGSLSLVTVVGNILVMLSIKVNR QLQTVNNYFLFSLACADLIIGAFSMNLYTLYIIKGYWPLGAVVCDLWLALDYVVSNASVM NLLIISFDRYFCVTKPLTYPARRTTKMAGLMIAAAWVLSFVLWAPAILFWQFVVGKRTVP DNQCFIQFLSNPAVTFGTAIAAFYLPVVIMTVLYIHISLASRSRVHKHRPEGPKEKKAKT LAFLKSPLMKPSIKKPPPGGASREELRNGKLEEAPPPALPPPPRPVADKDTSNESSSGSA TQNTKERPPTELSTTEAATTPALPAPTLQPRTLNPASKWSKIQIVTKQTGSECVTAIEIV PATPAGMRPAANVARKFASIARNQVRKKRQMAARERKVTRTIFAILLAFILTWTPYNVMV LVNTFCQSCIPERVWSIGYWLCYVNSTINPACYALCNATFKKTFRHLLLCQYRNIGTAR
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is inhibition of adenylate cyclase.
Gene References into Functions
The findings of this study indicated that the cocaine-like S(D) effects of muscarinic antagonists are primarily mediated through M1 receptors, with a minor contribution of M4 receptors.PMID:28442355
In the present study, the functional coupling of Gi/o protein-coupled receptors to GalR1, and the CB1 receptor subtype for endocannabinoids were analyzed in the 3xTg-AD mice model of Alzheimer's disease in the prodromal and advanced stages. In addition, the activity mediated by Gi/o protein-coupled M2/4 muscarinic receptor subtypes was also analyzed in brain areas involved in anxiety and cognition.PMID:27223629
Muscarinic acetylcholine receptor subtype 4 is essential for cholinergic stimulation of duodenal bicarbonate secretion in mice - relationship to D cell/somatostatinPMID:26084221
Allosteric activation of M4 muscarinic receptors improve behavioral and physiological alterations in early symptomatic Huntington's disease - YAC128 mice.PMID:26508634
the role of the M4 receptor in alcohol consumptionPMID:25445043
We show that M4 is a major mAChR subtype mediating the cholinergic inhibition of corticostriatal glutamatergic input on both striatonigral and striatopallidal medium spiny neurons (MSNs).PMID:24528004
The characterization of the orthosteric agonist, iperoxo, at the M(4) receptor.PMID:24807965
These data support a role for the M4AChR subtype in mediating the antipsychotic-like activity of BuTAC.PMID:23907402
Presence of M4 mAChR is sufficient and necessary to mediate the carbachol-induced membrane hyperpolarization and inhibition of SpECTs in laterodorsal tegmental nucleus neurons.PMID:22956788
M4R is involved in regulation of locomotor activity, social behavior, and sensorimotor gating in mice.PMID:22463818
Reducing M4 receptor signaling altered only select behavioral phenotypes in the Fmr1KO mouse model, suggesting that other targets are involved in the modulation of fragile X behaviors.PMID:22123412
Chrm4 receptor is located on presynaptic glutamatergic terminals afferent to the recorded pyramidal neuron, thus decreasing glutamate release.PMID:20600670
The muscarinic M(4) receptor is the functionally predominant subtype in mouse striatum.PMID:21114972
Different coupling of striatal M(2)/M(4)-mAChRs to the control of DA release in CPu versus NAc suggests targets to influence DA/ACh function differentially between striatal domains.PMID:20203199
a distinct subpopulation of neuronal M(4) mAChRs plays a critical role in modulating several important dopamine-dependent behaviors.PMID:20147565
muscarinic analgesia is exclusively mediated by a combination of M(2) and M(4) mAChRs at both spinal and supraspinal sites.PMID:12391271
M(4) mAChR plays a central role in mediating cholinergic control of keratinocyte migration by endogenous acetylcholine produced by these cellsPMID:12628458
M4 mAChRs modulate dopamine activity in motor tracts and act as inhibitory autoreceptors in striatum. Review.PMID:12675128
There is a crucial role for M4 receptors in the tonic and phasic regulation of acetylcholine efflux in the hippocampus as well as in cognitive processes. The M4 receptor participates in a tonic regulatory loop contolling basal acetylcholine levels.PMID:12874603
loss of M4 muscarinic receptor control of cholinergic function effectuates a state of dopaminergic hyperexcitabilityPMID:15231726
M4 increases expression of "migratory" integrins; M4 effects resulted from inhibition of the inhibitory pathway involving the adenylyl cyclase-cyclic AMP-protein kinase A pathwayPMID:15263021
This study indicate that both M4 mediate the muscarinic autoinhibition in ACh release in the longitudinal muscle with myenteric plexus preparation of the mouse ileum.PMID:15574798
M2 and M5 muscarinic receptors but not M4 muscarinic receptor or D2 dopamine receptors are needed for male USV production during male-female interactionsPMID:18382674
Results suggest that GRK5 deficiency leads to a reduced hippocampal ACh release and cholinergic hypofunction by selective impairment of desensitization of presynaptic M2/M4 autoreceptors.PMID:19478075