MTLHSNSTTSPLFPNISSSWVHSPSEAGLPLGTVSQLDSYNISQTSGNFSSNDTSSDPLG GHTIWQVVFIAFLTGFLALVTIIGNILVIVAFKVNKQLKTVNNYFLLSLACADLIIGVIS MNLFTTYIIMNRWALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRT TKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAFY MPVTIMTILYWRIYKETEKRTKELAGLQASGTEAEAENFVHPTGSSRSCSSYELQQQGTK RSSRRKYGGCHFWFTTKSWKPSAEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSET RAIYSIVLKLPGHSTILNSTKLPSSDNLQVPDKDLGTMDVERNAHKLQAQKSMDDRDNCQ KDFSKLPIQLESAVDTAKTSDTNSSVDKTTAALPLSFKEATLAKRFALKTRSQITKRKRM SLIKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTYWNLGYWLCYINSTVNP VCYALCNKTFRTTFKMLLLCQCDKRKRRKQQYQQRQSVIFHKRVPEQAL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is Pi turnover.
Gene References into Functions
The expression of M3-mAChR was down-regulated in the myocardium from aged mice and D-galactose-treated mice, while the expression levels of caspase-1 and its downstream molecule IL-1beta were significantly increased.PMID:30196290
Stimulation of the ERK pathway in Gnb5(-/-) cells by epidermal growth factor restored M3R-stimulated insulin release to near normal levels. Identification of the novel role of Gbeta5-R7 in insulin secretion may lead to a new therapeutic approach for improving pancreatic beta-cell functionPMID:28687610
s. Moreover, we found that M3 cholinergic receptor (CHRM3) was upregulated in a large subset of benign prostatic hyperplasia (BPH) tissues compared with normal tissues. Activation of CHRM3 also promoted the proliferation of BPH cells.PMID:27167157
early intervention with cholinergic receptor muscarinic (ChRM)-3 blocker reversed the progression of airway hyperreactivity in the neonatal exposure model, whereas beta2-adrenoceptor agonists had no such effectPMID:28619712
We found that knockout of the M2/3 receptor significantly inhibited ST37 acupuncture-induced enhancement of gastric motility, jejunal motility, and colonic motility.PMID:27978539
Type 3 muscarinic receptors contribute to intestinal mucosal homeostasis and clearance of Nippostrongylus brasiliensis through induction of TH2 cytokines.PMID:27173511
Arthritis-induced joint destruction was significantly stronger in mice with M3 muscarinic acetylcholine receptor deficiency.PMID:26785775
The effects of muscarinic receptor M3 knockout on cathepsin K expression, bone density and biomechanical properties of bone are reported.PMID:26002583
results suggest that the autoantibodies against peptides of the second extracellular loop of M3R are not pathogenic in vivo and they are not suitable as biomarkers for pSS diagnosisPMID:26901532
Expression of the M3 receptors mediating cholinergic contractile stimuli of the detrusor muscle was dysregulated in both Mras-/- males and females, although only males exhibited a urinary phenotype.PMID:26516777
The study screened CrkL binding proteins using RNA interference (RNAi) and identified Sorbs1 and Sorbs2 as two proteins that are enriched at AChR clusters and are required for the formation of AChR aggregation in vitro.PMID:26527617
Activation of Chrm3 inhibits the recruitment of beta-arrestin-2 to odorant receptors, resulting in a potentiation of odor-induced responses in olfactory sensory neurons.PMID:25800153
The muscarinic M3R receptor interacts directly with NOSTRIN at the plasma membrane in the aorta.PMID:26169369
Cholinergic signalling via the M3R is essential for optimal Th1 and Th2 adaptive immunity to infection.PMID:25629518
These findings indicate that the M(3) receptor on structural cells plays a proinflammatory role in CS-induced neutrophilic inflammation, whereas the M(3) receptor on inflammatory cells does not.PMID:25381025
Our results identify a novel candidate mouse gene, Zfp277, whose expression pattern is compatible with a role in mediating divergent effects of Chrm3 and Chrm1 gene ablation on murine intestinal neoplasia.PMID:24694019
M3 acetylcholine receptors are increased in beta cells as a mechanism to compensate for amino acid deficiencyPMID:24695728
In this review, genetic modifications of muscarinic M3 receptor cause robust alterations in insulin levels and glucose tolerance.PMID:24114586
The upregulation of M-mAChR during myocardial hypertrophy could relieve the hypertrophic response provoked by angiotensin II.PMID:24028210
Data indicate that acetylcholine contributes to allergen-induced remodeling and smooth muscle mass via the muscarinic M3 receptor.PMID:24156289
Activation of alpha2A-AR and muscarinic M3 receptors affects the initial [Ca(2+)] response to increase of glucose from 3 to 20mM in BETA-cells.PMID:24565843
M2 receptors play an essential role in the generation of intestinal rhythmic motor activity, and M3 receptors have a modulatory role in controlling the periodicity of the rhythmic activityPMID:23889852
These results suggest that mAChRs in mouse colonic epithelial cells consist of two subtypes, M1 (80 %) and M3 (20 %).PMID:23242454
M3 receptor and VGLUT2 are co-localized on intraganglionic laminar endings of esophagus.PMID:23742744
in murine ophthalmic arteries the muscarinic M3 receptor subtype mediates cholinergic endothelium-dependent vasodilation and endothelium-independent vasoconstriction.PMID:24408978
Oscillatory Ca2+ increase in response to M3 muscarinic acetylcholine receptor stimulation is dependent upon a moderate IP3 increase, which is suitable for causing Ca(2+)-dependent IP3-induced Ca2+ release.PMID:23747049
the restricted M3 muscarinic receptors expression contributes to the propagation Ca2+ signaling triggered by Acetylcholine.PMID:23407022
Immunization of muscarinic acetylcholine 3 receptor induces the secretion of IL-17 and IFN-gamma in NOD-scid mice.PMID:23232510
Blockage of mAChR exerts anti-inflammatory properties, and M3R plays an important role in the LPS-induced lung inflammationPMID:22910223
Data suggest that although M3R is located on both myocardial cells and endocardial endothelial cells, only endothelial M3R mediates positive inotropy in response to muscarinic agonists via activation of cyclooxygenase 2 in the atrium.PMID:22726658
These results indicate that alpha7-nAChR are not involved in the regulation of bone collagen synthesis whereas M3R exert stimulatory effects on cancellous bone microarchitecture, flexural rigidity, and bone matrix synthesis.PMID:22871384
Studies with M3R mutant mice strongly suggest that strategies aimed at enhancing signaling through beta-cell M3R receptor may be useful in the treatment of type 2 diabetes by promoting insulin release and improving beta-cell function in general.[review]PMID:22525375
Findings support the concept that the inhibitory effects of SPL on M3R activity are mediated by RGS4.PMID:22730439
M-mAChR overexpression dramatically reduced the incidence of arrhythmias and decreased the mortality in a mouse model of myocardial ischemia-reperfusion (I/R).PMID:21785809
interplay of Chrm3 and beta-catenin signaling is important for intestinal mucosal differentiation and neoplasia.PMID:21705482
Caveolae disruption decreased muscarine-induced bronchoconstriction in wild-type and abolished it in M2R(-/-) and M3R(-/-) mice. Thus M2R and M3R signaling pathways require intact caveolae.PMID:20023174
M receptors mediate cholinergic vasodilation in cutaneous, skeletal muscle, and renal interlobar arteries.PMID:21335473
The expression of M3R in different cell types during skin wound healing is time-dependent.PMID:20707271
M(3)-muscarinic receptor-mediated augmentation of sustained insulin release is largely independent of G protein-coupling but involves phosphorylation-/arrestin-dependent coupling of the receptor to protein kinase D1PMID:21078968
Results suggest acetylcholine-M3 muscarinic receptor may be involved in itching associated with some chronic pruritus diseases such as atopic dermatitis.PMID:20595784
NF-kappaB signalling plays an essential role in controlling the expression of the muscarinic M(3) receptor.PMID:20541544
determination of m2 and m3 muscarinic receptors in the central auditory systemPMID:20665816
Signaling through the M(3) muscarinic receptor favors bone mass accrual by decreasing sympathetic activity.PMID:20197056
The M3-muscarinic receptor regulates learning and memory in a receptor phosphorylation/arrestin-dependent manner.PMID:20439723
Chrm3 plays a critical role in the liver injury response by modulating hepatocyte proliferation and apoptosisPMID:20197374
M3 mAChRs in distinguish parvalbumin-positive from cholecystokinin-positive basket cells; findings demonstrate that cell type-specific cholinergic specializations are present on neurochemically distinct interneuron subtypes in the hippocampusPMID:20427660
RGS2 is an important cholinergic regulator in the atrium. RGS2(-/-) mice have enhanced susceptibility to atrial fibrillation via enhanced M3 muscarinic receptor activity.PMID:19966055
The role of M3 muscarinic receptor in smooth muscle contraction is analyzed in M3 knockout mice.PMID:12486155
When the muscarinic M3 receptor is deleted, cholinergic-induced relaxation is unmasked in the stomach fundus.PMID:12538821
The M3 mAChRs are involved in exocrine gland secretion, smooth muscle contractility, pupil dilation, food intake, and weight gain. Review.PMID:12675128