Recombinant Mouse Mitofusin-1 (Mfn1)

Code: CSB-CF773966MO
Size:
20μg
20μg100μg
US$8039
Quantity:
Express system: in vitro E.coli expression system
Species: Mus musculus (Mouse)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
Mfn1
Uniprot NO.
Alternative Names
Mfn1; Mitofusin-1; Transmembrane GTPase MFN1
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
1-741
Target Protein Sequence
MAETVSPLKHFVLAKKAITAIFGQLLEFVTEGSHFVEATYRNPELDRIASEDDLVEIQGY RNKLAVIGEVLSRRHMKVAFFGRTSSGKSSVINAMLWDKVLPSGIGHTTNCFLSVEGTDG DKAYLMTEGSDEKKSVKTVNQLAHALHMDKDLKAGCLVHVFWPKAKCALLRDDLVLVDSP GTDVTTELDIWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWD ASASEPEYMEDVRRQHMERCLHFLVEELKVVSPSEARNRIFFVSAKEVLNSRKHKAQGMP EGGGALAEGFQARLQEFQNFEQTFEECISQSAVKTKFEQHTIRAKQILDTVKNILDSVNV AAAEKRVYSMEEREDQIDRLDFIRNQMNLLTLDVKKKIKEVTEEVANKVSCAMTDEICRL SVLVDEFCSEFHPTPSVLKVYKSELNKHIEDGMGRNLADRCTNEVNASILQSQQEIIENL KPLLPAGIQNKLHTLIPCKKFDLSYDLNCHKLCSDFQEDIVFRFSLGWSSLVHRFLGSTN AQRVLLGLSEPIFQVPRSLASTPTAPSNPAAPDNAAQEELMITLITGLASLTSRTSMGII VVGGVIWKTVGWKLISVTLSMYGALYLYERLTWTTRAKERAFKQQFVNYATEKLQMIVSF TSANCSHQVQQEMATTFARLCQQVDVTQKHLEEEIARLSKEIDQLEKIQNNSKLLRNKAV QLESELENFSKQFLHPSSGES
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Mitochondrial outer membrane GTPase that mediates mitochondrial clustering and fusion. Membrane clustering requires GTPase activity. It may involve a major rearrangement of the coiled coil domains. Mitochondria are highly dynamic organelles, and their morphology is determined by the equilibrium between mitochondrial fusion and fission events. Overexpression induces the formation of mitochondrial networks (in vitro). Has low GTPase activity.
Gene References into Functions
  1. data posit MFN1-mediated mitochondrial dynamics in POMC neurons as an intrinsic nutrient-sensing mechanism and unveil an unrecognized link between this subset of neurons and insulin release. PMID:28591639
  2. These results highlight the crucial role of MFN1 in maintaining the competency of the STING pathway. PMID:28729291
  3. Despite apparent mitochondrial dysfunction, hearts deficient in both Mfn1 and Mfn2 are protected against acute myocardial infarction due to impaired mitochondria/sarcoplasmic reticulum tethering. PMID:27228353
  4. We found that mouse embryonic fibroblasts lacking Mfn2 have altered lipid droplet morphology. However, triacylglycerol biosynthesis was not dependent on ER-mitochondrial tethering mediated by mitofusins. Lastly, Mfn2 does not have a role in adipocyte differentiation. PMID:27404125
  5. MFN1 deficiency leads to defects in mitochondrial activity and male infertility. PMID:26711429
  6. Ablating Mfn1 eliminates the cardiac-related lethality of Mff knockout mice. PMID:26598616
  7. Data suggest that mitochondrial fusion and fission events are regulated by four GTPases: Mfn1, Mfn2, OPA1 (optic atrophy 1 protein), and Drp1 (dynamin 1-like protein). [REVIEW] PMID:26375863
  8. Authors present evidence that metabolically challenged mitochondria undergo active fusion to suppress oxidative stress. In response to glucose starvation, mitofusin 1 (MFN1) becomes associated with the protein deacetylase HDAC6. PMID:25271058
  9. These findings suggest that mitochondrial impairment is a very early event in Alzheimer disease pathogenesis and abnormal expression of Mfn1 and Mfn2 caused by excessive intracellular Abeta is the possible molecular mechanism. PMID:24710686
  10. Data identify MFN1 as an ERK target to modulate mitochondrial shape and apoptosis. PMID:25801171
  11. A fine balance of Mfn1 levels is maintained by MARCH5-mediated quality control on acetylated Mfn1. PMID:24722297
  12. Mitochondrial shape governs BAX-induced membrane permeabilization and apoptosis via Mfn1. PMID:25482509
  13. Data unmask an important role for mitochondrial dynamics governed by Mfn1 and Mfn2 in Agrp neurons in central regulation of whole-body energy metabolism. PMID:24074868
  14. Our findings establish that Mfn-1 and Mfn-2 are essential in mediating mitochondrial remodeling during postnatal cardiac development, a time of dramatic transitions in the bioenergetics and growth of the heart. PMID:22904094
  15. Data suggest that Mfn-1 deletion in cardiomyocytes confers protection against reactive oxygen species-induced mitochondrial dysfunction. PMID:22037195
  16. Patterned Purkinje cell degeneration is dependent on caspase activation, leading to the marked decrease of mitofusion 1 in the Harlequin cerebellum. PMID:20974255
  17. Double Mfn-null cells show neither outer nor inner membrane fusion, while mitochondria in OPA1-null cells contain multiple matrix compartments bounded together by a single outer membrane, consistent with uncoupling of outer versus inner membrane fusion. PMID:19477917
  18. results suggest that the heptad repeat region (HR2) of mfn1 functions as a mitochondrial tether before fusion PMID:15297672
  19. OPA1, Mfn1 and Mfn2 have roles in mitochondrial fusion, cell growth, mitochondrial membrane potential, and cellular respiration PMID:15899901
  20. Our results highlight the functional importance of Mfn1-Mfn2 heterooligomeric complexes and the close interplay between the two mitofusins in the control of mitochondrial fusion. PMID:17296794
  21. IL-6 induces Bcl-2 expression to perform cytoprotective functions in response to oxygen toxicity, and that this effect is mediated by alterations in the interactions between Bak and Mfn1/Mfn2. Bcl-2 inhibited the interaction between Bak and Mfn1. PMID:19168699

Show More

Hide All

Subcellular Location
Mitochondrion outer membrane; Multi-pass membrane protein.
Protein Families
TRAFAC class dynamin-like GTPase superfamily, Dynamin/Fzo/YdjA family, Mitofusin subfamily
Tissue Specificity
Detected in adult heart. Detected in embryos (at protein level). Widely expressed.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products