MSASNVSLLHETSRQVAAGGSAGLVEICLMHPLDVVKTRFQVQRSVTDPQSYRTVRGSFQ MIFRTEGLFGFYKGIIPPILAETPKRAVKFSTFELYKKFLGYMSLSPGLTFLIAGLGSGL TEAVVVNPFEVVKVGLQVNRNLFKEQPSTFAYARQIIKKEGLGFQGLNKGLTATLGRHGI FNMVYFGFYHNVKNIIPSSKDPTLEFLRKFGIGFVSGTMGSVFNIPFDVAKSRIQGPQPV PGEIKYRSCFKTMEMIYREEGILALYKGLVPKVMRLGPGGGVMLLVYEYTYAWLQENW
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Transports C5-C7 oxodicarboxylates across the inner membranes of mitochondria. Can transport 2-oxoadipate, 2-oxoglutarate, adipate, glutarate, and to a lesser extent, pimelate, 2-oxopimelate, 2-aminoadipate, oxaloacetate, and citrate.
Gene References into Functions
Disruption of Slc25a21 is associated with orofacial defects and otitis media due to diminished expression of a neighboring gene, pax9.PMID:24642684
ODC-AS may promote lipid accumulation during adipocyte differentiation and play an important role in the regulation of lipid metabolism in adipose tissues. [ODS-AS]PMID:19825180