Recombinant Mouse Lysosome-associated membrane glycoprotein 1 (Lamp1)

Code: CSB-CF012738MO
Size:
20μg
20μg100μg
US$5353
Quantity:
Express system: in vitro E.coli expression system
Species: Mus musculus (Mouse)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
Lamp1
Uniprot NO.
Alternative Names
Lamp1; Lamp-1; Lysosome-associated membrane glycoprotein 1; LAMP-1; Lysosome-associated membrane protein 1; 120 kDa lysosomal membrane glycoprotein; CD107 antigen-like family member A; LGP-120; Lysosomal membrane glycoprotein A; LGP-A; P2B; CD antigen CD107a
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
25-406
Target Protein Sequence
LFEVKNNGTTCIMASFSASFLTTYETANGSQIVNISLPASAEVLKNGSSCGKENVSDPSLTITFGRGYLLTLNFTKNTTRYSVQHMYFTYNLSDTEHFPNAISKEIYTMDSTTDIKADINKAYRCVSDIRVYMKNVTVVLRDATIQAYLSSGNFSKEETHCTQDGPSPTTGPPSPSPPLVPTNPTVSKYNVTGNNGTCLLASMALQLNITYLKKDNKTVTRAFNISPNDTSSGSCGINLVTLKVENKNRALELQFGMNASSSLFFLQGVRLNMTLPDALVPTFSISNHSLKALQATVGNSYKCNTEEHIFVSKMLSLNVFSVQVQAFKVDSDRFGSVEECVQDGNNMLIPIAVGGALAGLVLIVLIAYLIGRKRSHAGYQTI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Lysosomal membrane glycoprotein which plays an important role in lysosome biogenesis, autophagy, and cholesterol homeostasis. Plays also an important role in NK-cells cytotoxicity. Mechanistically, participates in cytotoxic granule movement to the cell surface and perforin trafficking to the lytic granule. In addition, protects NK-cells from degranulation-associated damage induced by their own cytotoxic granule content. Presents carbohydrate ligands to selectins. Also implicated in tumor cell metastasis.
Gene References into Functions
  1. larger autophagic vacuoles that colocalize with early endosome antigen 1 (EEA1) but not with lysosomal-associated membrane protein (LAMP)-1 were much more frequently formed in Rab7(Deltapan) pancreatic acinar cells. PMID:28588238
  2. LIN28A inhibits lysosomeassociated membrane glycoprotein 1 protein expression in embryonic stem and bladder cancer cells. PMID:29749495
  3. Both LAMP-1 and LAMP-2 are involved in C2C12 myotube formation and LAMP-2 may contribute dominantly to it. PMID:30068868
  4. A recombinant DNA vaccine, pVAX-LAMP/Gn was previously proved efficient, requiring long-term evaluations. pVAX-LAMP/Gn established memory responses within a long-term protection. Lysosome-targeted strategy showed promise on Gn-based DNA vaccine and further investigations are warranted in other immunogenic Hantaviral antigens. PMID:27923570
  5. The results presented here show the major role of LAMP-2 in caveolin traffic and membrane repair and consequently in T. cruzi invasion. PMID:28586379
  6. Here, we identify lamellar inclusions as the subcellular site of lipid accumulation in neurons, we uncover a vicious cycle of cholesterol synthesis and accretion, which may cause gradual neurodegeneration, and we reveal how beta-cyclodextrin, a potential therapeutic drug, reverts these changes. Our study provides new mechanistic insight in NPC disease and uncovers new targets for therapeutic approaches. PMID:27466344
  7. we demonstrate that galectin-3 induces MMP9 expression via p38 MAP-kinase pathway. LAMP1 was demonstrated to serve as one of the key mediators of galectin-3-induced MMP9 expression via p38 MAPK pathway PMID:25739356
  8. Although surface LAMP1 promotes interactions with organ ECM and BM, carbohydrates on LAMP1 play a decisive role in dictating lung metastasis. PMID:25614122
  9. LAMP luminal domain also showed to be essential for Gag traffic through lysosomes. PMID:24932692
  10. The results thus for the first time provide direct evidence that cell surface LAMP1 facilitates lung metastasis by providing ligands for galectin-3 which has been shown to be expressed in highest amounts on lungs and constitutively on its vascular endothelium. PMID:24845565
  11. Caveolin-1 associated adenovirus entry into human corneal cells. PMID:24147000
  12. study has shown that Lassa virus entry requires a pH-regulated engagement of alpha-DG and LAMP1 both of which need to be glycosylated PMID:24970085
  13. CD107a/LAMP-1 has a role in the protection of NK cells from degranulation-associated suicide PMID:23847195
  14. LAMP proteins retain TAPL on the limiting membrane of endosomes and prevent its sorting to intraluminal vesicles. PMID:22641697
  15. a novel mechanism showing how Salmonella acquires LAMP1 through a SipC-Syntaxin6-mediated interaction probably to stabilize their niche in macrophages PMID:22190682
  16. The kinetic observations provide sufficient quantitative evidence that in P338D(1) cells the bulk of newly-synthesized endogenous LAMP-1 first appeared in early endosomes, before it was delivered to late endosomes and lysosomes about 25 min later. PMID:21457058
  17. The finding raises the possibility that the expression of SSEA-1-positive LAMP-1 is associated with the "stemness" of neural stem cells. PMID:20360060
  18. Using LAMP1/2 knock out cells the authors show that these two proteins are important for Trypanosoma cruzi infection of host cells, both in entrance and intracellular development, conceivably by being the major source of sialic acid for Trypanosoma cruzi. PMID:20561595
  19. LAMP-1 can serve as a cell surface binding site for amelogenin on dental follicle cells and cementoblasts PMID:20382373
  20. Our results suggested that the increase in LAMP-1 was enhanced by the accumulation of amyloid-beta occurring during aging. Our findings coincided with the pathological hallmarks of Alzheimer's disease. PMID:20025930
  21. The Th1-specific costimulatory molecule, m150, is a posttranslational isoform of lysosome-associated membrane protein-1. PMID:12165502
  22. LAMP-1 is differentially expressed during spermiogenesis; LAMP-1 appears late in spermatogenesis (Acrosome-phase) PMID:12950108
  23. Utilizing Tandem MS (MS/MS) sequencing, we report the novel finding of the 95 kDa murine transmembrane protein, LAMP-1, originally identified as a lysosomal membrane protein that is also found at the cell surface, as an [A - 4] cell binding protein. PMID:16214432
  24. We corroborated that the perinuclear clustering of late endocytic organelles containing Lamp1 (lysosome-associated membrane protein 1) is reduced in BLOC-3-deficient murine fibroblasts. PMID:16249233
  25. LAMP proteins are required for fusion of lysosomes with phagosomes. PMID:17245426
  26. Data show that cells lacking either LAMP-1 or LAMP-2 alone formed phagosomes that gradually acquired microbicidal activity and curtailed bacterial growth, but LAMP-1 and LAMP-2 double-deficient cells failed to kill engulfed Neisseria gonorrhoeae. PMID:17506821
  27. LAMP1 binds amelogenin through residues 226-251 PMID:17708745
  28. F. tularensis-containing endosomes associated with early endosome antigen 1 (EEA1) followed by lysosome-associated membrane protein 1 (LAMP-1), with peak coassociation frequencies occurring at 30 and 120 min postinoculation, respectively PMID:18426871
  29. the activation-induced degranulation of Fas ligand has distinct requirements and involves different mechanisms than those of the granule markers CD63 and CD107a/Lamp-1 PMID:19079288
  30. The DeltapdpA strain was capable of intracellular replication but remained associated with the lysosomal marker LAMP-1. PMID:19372155

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein. Endosome membrane; Single-pass type I membrane protein. Lysosome membrane; Single-pass type I membrane protein. Late endosome membrane; Single-pass type I membrane protein. Cytolytic granule membrane; Single-pass type I membrane protein.
Protein Families
LAMP family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products