MGTRGLQGLGGRPQGRGCLLLAVAGATSLVTLLLAVPITVLAVLALVPQDQGRRVEKIIGSGAQAQKRLDDSKPSCILPSPSSLSETPDPRLHPQRSNASRNLASTSQGPVAQSSREASAWMTILSPAADSTPDPGVQQLPKGEPETDLNPELPAAHLIGAWMSGQGLSWEASQEEAFLRSGAQFSPTHGLALPQDGVYYLYCHVGYRGRTPPAGRSRARSLTLRSALYRAGGAYGRGSPELLLEGAETVTPVVDPIGYGSLWYTSVGFGGLAQLRSGERVYVNISHPDMVDYRRGKTFFGAVMVG
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Cytokine that binds to LTBR/TNFRSF3. May play a specific role in immune response regulation. Provides the membrane anchor for the attachment of the heterotrimeric complex to the cell surface.
Gene References into Functions
The expression of lymphotoxin (LT)-B was significantly downregulated in the absence of T cells from nude mice and was recovered after the transfusion of T cells.PMID:25266629
TNF is able to upregulate LT-beta expression in hepatic cells at the transcriptional level by the binding of NF-kappaB p50/p65 heterodimers and Ets1 to their respective sites in the LT-beta promoter.PMID:22742857
Lymphotoxin-beta-receptor (LTbetaR) signaling, a pathway essential for lymphoid organogenesis, abrogates tertiary lymphoid organ development in heart transplantation.PMID:21926237
LTbeta RNA is detectable in embryos ranging from 5.5 to 18.5 days of development, e.g., in peripheral lymph nodes, Peyer's patches, thymus and skin of the E18.5 embryo and fetal liver of E12.5.PMID:11994460
membrane lymphotoxin beta contributes to anti-leishmanial immunity by controlling structural integrity of lymphoid organsPMID:12115620
The organogenic function of B-LTbeta is almost entirely restricted to spleen, where it supports the correct lymphoid architecture that is critical for an effective humoral immune response.PMID:12354378
microenvironment in peripheral lymphoid organs associated with lymphotoxin alpha/lymphotoxin beta-lymphotoxin beta receptor signaling and chemokine production is critical for recruitment efficiency of dendritic celPMID:12560241
membrane LT-beta is important in resistance to Theiler's virus infectionPMID:12882833
Lymphotoxin-mediated adhesion molecule expression may be important in the development of graft-versus-host skin disease.PMID:14734744
LTbeta, LTbeta receptor, and IFNgamma are involved in oval cell-mediated, but not hepatocyte-mediated, liver regeneration, and the absence of these pathways impairs the oval cell-dependent regenerative response.PMID:15660390
The lymphotoxin beta signaling pathway is an essential effector pathway for host defense against the beta-herpesvirus muromegalovirus (MCMV).PMID:15905567
Data show that, as an ectodysplasin target, lymphotoxin-beta regulates hair phenotype in developing hair follicles.PMID:16738056
Expression of LTbeta on lymphocytes enhances the induction of immune responses against limiting amounts of antigenPMID:16841297
Expression of lymphotoxin-alphabeta on antigen-specific T cells is required for DC function.PMID:17452522
Activation of LTbetaR by LTalphabeta mainly expressed on T lymphocytes is crucial for the down regulation of the inflammatory response in this experimental model.PMID:17590442
LTbeta shows a primary early function in periderm differentiation, with later transient effects on epidermal and hair follicle differentiation.PMID:17673451
signal was essential for primary B cell cluster formation with initial differentiation of follicular dendritic cells (FDCs) in neonatal mice.PMID:17982070
LTbetaR on hepatic stellate cells may be involved in signaling with LTbeta-expressing liver progenitor cells mediating recruitment of progenitor cells, hepatic stellate cells, & leukocytes for wound healing & regeneration during chronic liver injury.PMID:19111021