PELSGSRCPEPCDCAPDGALRCPGPRAGLARLSLTYLPVKVIPSQAFRGLNEVVKIEISQ SDSLERIEANAFDNLLNLSEILIQNTKNLLYIEPGAFTNLPRLKYLSICNTGIRTLPDVS KISSSEFNFILEICDNLYITTIPGNAFQGMNNESITLKLYGNGFEEVQSHAFNGTTLISL ELKENIYLEKMHSGTFQGATGPSILDVSSTKLQALPSHGLESIQTLIATSSYSLKTLPSR EKFTSLLVATLTYPSHCCAFRNLPKKEQNFSFSIFENFSKQCESTVREANNETLYSAIFE ENELSGWDYDYDFCSPKTLQCTPEPDAFNPCEDIMGYAFLRVLIWLINILAIFGNLTVLF VLLTSRYKLTVPRFLMCNLSFADFCMGLYLLLIASVDSQTKGQYYNHAIDWQTGSGCSAA GFFTVFASELSVYTLTVITLERWHTITYAVQLDQKLRLRHAIPIMLGGWIFSTLMATLPL VGVSSYMKVSICLPMDVESTLSQVYILSILLLNAVAFVVICACYVRIYFAVQNPELTAPN KDTKIAKKMAILIFTDFTCMAPISFFAISAAFKVPLITVTNSKVLLVLFYPVNSCANPFL YAVFTKAFQRDFFLLLSRFGCCKHRAELYRRKEFSACTFNSKNGFPRSSKPSQAALKLSI VHCQQPTPPRVLIQ
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Receptor for lutropin-choriogonadotropic hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase.
Gene References into Functions
Activating mutations in LHCGR cause familial male-limited precocious pubertyPMID:28339861
Study tested for the first time a role of ZFP36L2 in the decay of LHR mRNA, when transcription was inhibited; results of our cell-based assay support the conclusion that LHR mRNA expression is controlled post-transcriptionally by ZFP36L2.PMID:28455422
FSHR and LHR proteins are significantly upregulated in CCs surrounding oocytes arrested at the 2-cell stage, reflecting their developmental incompetence.PMID:24476692
Triptorelin and cetrorelix induce immune responses and affect uterine development and expressions of genes and proteins of ESR1, LHR, and FSHRPMID:27075695
Data suggest that persistent cAMP signals from internalized luteinizing hormone receptor (LH receptors) contribute to transmitting LH effects inside follicle cells and ultimately to the oocyte.PMID:26828746
Demonstrate the presence of LH receptors. Activation resulted in a dose-dependent increase in glucose-induced release of insulin.PMID:25670721
LHCGR signaling in regulating the Ahr message involves protein kinase A pathway and is attributable to decreased transcription rate.PMID:24145128
Data from mutant mouse strain (gain-of-function mutation in LHR, D578G; most common mutation found in familial male-limited precocious puberty) confirm that LHR is critical for male steroidogenesis, gametogenesis, and Leydig cell development.PMID:23861372
LH/hCG tightly up-regulates MKP-3 which in turn, dephosphorylates ERK1/2 and drives p21 expression.PMID:23261984
Data suggest that Lhcgr in endometrium and luteinizing hormone in blastocyst are involved in embryo/blastocyst implantation; expression of Lhcgr is up-regulated in endometrial epithelium in estrus cycle at time of implantation readiness (estrus).PMID:23464498
Through the LHR, LH/hCG tightly regulates MKP-2 expression, which modulates the induction of CYP11A1 by 8Br-cAMP.PMID:23471219
Expression of LH receptor in nonpregnant mouse endometrium.PMID:22875961
Testicular CYP1B1 expression is regulated by LH through a PRKA-mediated pathway.PMID:21389345
Positive immunoreaction for LH receptors was present in the nuclei of urethral epithelium and endothelial cells of cavernous spaces in the corpus cavernosum and corpus spongiosum penis.PMID:20798391
Role of RXFP2 in mediating androgen-induced inguinoscrotal testis descent in LH receptor knockout mice.PMID:20154177
The study provides the first in vivo evidence linking the LH receptor, the EGFR, and ERK1/2 as sequential components of a pathway that regulates ovarian Cyp19a1 expression.PMID:20093417
Diminution of Abeta accumulation in the absence of LH receptor supports the contention that dysregulation of LH may impact the pathogenesis of Alzheimer disease.PMID:20142765
review of studies of Lhr expression and function using transgenic and knockout mouse models, including function as promoters of tumorsPMID:11988311
review of knockout mice studies of the effect of inactivation of Lhr on phenotypePMID:11988312
Strain susceptibility to adrenocortical tumorigenesis (DBA/2J >> FVB/N) correlated with the expression of GATA-4 and LHR, implicating these factors in the process of adrenocortical neoplasia in response to continuous gonadotropin stimulation.PMID:12933687
Positive and reciprocal feed-forward amplification link between LHR and GATA-4 expressionleads to formation of the LH-dependent adrenocortical tumors.PMID:15256532
Lutropin and progesterone receptors exert distinct but coordinate effects on transactivation of the ADAMTS-1 gene in granulosa cells in vivo and in vitroPMID:15256533
In LH receptor knockout mice LH and CG control uterine functions directly as well as indirectly through increasing ovarian synthesis of steroid hormones.PMID:15836959
function of the extragonadal LHR using LHR-knockout mice, in which the ovaries of prepubertal mice were orthotopically replaced with pieces of wild type ovaryPMID:15951841
activation of the endogenous lutropin/choriogonadotropin receptor (LHR) in mouse Leydig tumor cells leads to the tyrosine phosphorylation of the focal adhesion kinase FAKPMID:16293639
We propose that the LHR-mediated stimulation of the ERK1/2 cascade in Leydig cells depends on two independent pathways.PMID:17727840
The mRNA levels for several germ cell-specific proteins were up-regulated at 5 weeks of age in both WT and YHR(+) mice.PMID:19013498