Home
Product
Protein
Transmembrane Proteins
Recombinant Mouse Low affinity immunoglobulin epsilon Fc receptor (Fcer2)

Recombinant Mouse Low affinity immunoglobulin epsilon Fc receptor (Fcer2)

Code: CSB-CF008534MO

Rate （N/A）
Review （0）

Size:

20μg100μg

US$4971

Quantity:

Express system: in vitro E.coli expression system

Species: Mus musculus (Mouse)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Fcer2

Uniprot NO.

P20693

Alternative Names

Fcer2; Fcer2a; Low affinity immunoglobulin epsilon Fc receptor; Fc-epsilon-RII; Lymphocyte IgE receptor; CD antigen CD23

Species

Mus musculus (Mouse)

Source

in vitro E.coli expression system

Expression Region

1-331

Target Protein Sequence

MEENEYSGYWEPPRKRCCCARRGTQLMLVGLLSTAMWAGLLALLLLWHWETEKNLKQLGDTAIQNVSHVTKDLQKFQSNQLAQKSQVVQMSQNLQELQAEQKQMKAQDSRLSQNLTGLQEDLRNAQSQNSKLSQNLNRLQDDLVNIKSLGLNEKRTASDSLEKLQEEVAKLWIEILISKGTACNICPKNWLHFQQKCYYFGKGSKQWIQARFACSDLQGRLVSIHSQKEQDFLMQHINKKDSWIGLQDLNMEGEFVWSDGSPVGYSNWNPGEPNNGGQGEDCVMMRGSGQWNDAFCRSYLDAWVCEQLATCEISAPLASVTPTRPTPKSEP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Low-affinity receptor for immunoglobulin E (IgE) and CR2/CD21. Has essential roles in the regulation of IgE production and in the differentiation of B-cells (it is a B-cell-specific antigen).

Gene References into Functions

Human and murine P2X7 activation induces the rapid shedding of CD23 from B cells, with a potential role for ADAM10 in this process. PMID:25155463
CD23 was shown to be sorted in an ADAM10-dependent manner into exosomes. PMID:20876574
B cells captured IgE by direct binding to the low-affinity IgE receptor, CD23. PMID:20870945
After exposure for 10 consecutive days to nebulized ovalbumin challenge, mice with disrupted Fc epsilon RI alpha subunit show low response to electrical field stimulation, less airway inflammation and goblet cell hyperplasia, and lower IL-13 in the lung. PMID:15128831
the functions of CD23 splice forms, b and bDelta5, in the apical to basolateral transcytosis of IgE/allergen complexes were investigated PMID:15702991
A positive internalization signal for IgE transepithelial transport is localized in the cytoplasmic region shared by all CD23 splice forms. This positive signal is negatively regulated by the intracellular CD23b-specific exon. PMID:15843555
mechanism by which endogenous B cell activity in vivo is regulated by norepinephrine involves stimulation of the beta2-adrenergic receptor on the B cell alone to increase the level of IgE produced in a p38 MAPK- and soluble CD23-dependent manner PMID:16920928
Overall, the data provide a direct demonstration for CD23's role in regulating IgE production in vivo and suggest that therapies aimed at stabilizing cell surface CD23 would be beneficial in controlling allergic disease. PMID:17324389
CD23 is an important regulatory factor for IgE production PMID:18828998