Lat; Linker for activation of T-cells family member 1; 36 kDa phospho-tyrosine adapter protein; pp36; p36-38
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
1-242
Target Protein Sequence
MEADALSPVGLGLLLLPFLVTLLAALCVRCRELPVSYDSTSTESLYPRSILIKPPQITVPRTPAVSYPLVTSFPPLRQPDLLPIPRSPQPLGGSHRMPSSQQNSDDANSVASYENQEPACKNVDADEDEDDYPNGYLVVLPDSSPAAVPVVSSAPVPSNPDLGDSAFSVESCEDYVNVPESEESAEASLDGSREYVNVSPEQQPVTRAELASVNSQEVEDEGEEEGVDGEEAPDYENLQELN
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Required for TCR (T-cell antigen receptor)- and pre-TCR-mediated signaling, both in mature T-cells and during their development. Involved in FCGR3 (low affinity immunoglobulin gamma Fc region receptor III)-mediated signaling in natural killer cells and FCER1 (high affinity immunoglobulin epsilon receptor)-mediated signaling in mast cells. Couples activation of these receptors and their associated kinases with distal intracellular events such as mobilization of intracellular calcium stores, PKC activation, MAPK activation or cytoskeletal reorganization through the recruitment of PLCG1, GRB2, GRAP2, and other signaling molecules.
Gene References into Functions
LatY136F knock-in mice displayed increased production of Th2-type IgG1 (a homologue of human IgG4) and developed multiple organ tissue lesions reminiscent of those seen in patients with of immunoglobulin G4-related disease (IgG4-RD). The development of these tissue lesions was highly sensitive to corticosteroid treatment like in IgG4-RD. LatY136F knock-in mouse strain represents a promising model for human IgG4-RD.PMID:29902238
this study shows that the site-specific delivery of linker for activation of T cells (LAT) in asthmatic mouse modelPMID:28063403
IFT20 is required for the delivery of the intracellular pool of LAT to the immune synapse in naive primary T lymphocytes.PMID:26715756
provide evidence that CD28 and the TCR complex regulate NF-kappaB via different signaling modules of GRB-2/VAV1 and LAT/ADAP pathways respectively.PMID:25455592
low level of LAT-PLC-gamma1 interaction was associated with Th2 polarized differentiation, and this may contribute to the etiology of asthma.PMID:24978613
These results suggest that proteasome-mediated degradation is involved in hypophosphorylated LAT and PLCgamma1 in Dow2-induced anergic T cells. The novel CD3-specific Ab, Dow2, may provide us with a unique tool for inducing immunosuppressionPMID:24595757
Sos1 has distinct roles in acting as a scaffold to oligomerize the adaptor protein LAT, and in guanine nucleotide exchange activityPMID:24222714
this analysis identified 65 proteins not associated before with the Zap70-Lat-SLP-76 network and thus should provide cues for future functional experiments.PMID:24584089
Data suggest that transmembrane adaptor protein LAT-PLCgamma1 (Phospholipase C gamma 1) signaling may function differently in various subsets of gammadelta T cells.PMID:24523509
chemotaxis toward antigen is controlled in mast cells by a cross-talk among FcepsilonRI, tetraspanin CD9, transmembrane adaptor proteins NTAL and LAT, and cytoskeleton-regulatory proteins of the ERM familyPMID:23443658
LAT-mediated signaling is essential for the continuous expansion of CD8 T cells during T cell priming, but is not required for contraction and memory maintenance of CD8 T cells.PMID:23401587
The lymphoproliferative disease observed in LAT-Y136F mutant mice is at least partially dependent on hyperactivation of Ras.PMID:23209318
our data suggest that LAT acts as a positive regulator of RANKL-induced osteoclastogenesis.PMID:22382685
LAT-deficient CTLs failed to upregulate FasL and produce gamma interferon after engagement with target cells and had impaired granule-mediated killing.PMID:22566687
PECAM-1-mediated inhibition of GPVI-dependent platelet responses result from recruitment of SHP-2-p85 complexes to tyrosine-phosphorylated PECAM-1, which diminishes the association of PI3K with activatory signaling molecules Gab1 and LATPMID:20723025
Data implicate that LAT has positive and negative roles in the regulation of mature T cells.PMID:20837489
While SLP-76 and LAT1 depend on each other for many of their functions, LAT2/SLP-76 interactions and SLP-76-independent LAT1 functions also mediate a positive signaling pathway downstream of FcepsilonRI in mast cells.PMID:20606011
mouse models revealed that LAT constitutes more than just a positive regulator of TCR signaling and plays a negative regulatory role that contributes to terminate antigen-driven T cell responses [Review]PMID:20107804
Data indicate that the binding of LAT to PLC-gamma1 is essential for the suppressive function of CD4(+)CD25(+) regulatory T cells.PMID:20130215
Data show that In quiescent T cells, both TCR and Lat existed in separate membrane domains (protein islands), and these domains concatenated after T cell activation.PMID:20010844
LAT is required for signaling via the T cell antigen receptor (TCR)PMID:11901197
inhibitory function for LAT that is critical for the differentiation and homeostasis of TH cellsPMID:12065839
critical role for integrated PLC-gamma1 and Ras-Erk signaling through LAT in T cell development and homeostasisPMID:12065840
LAT colocalizes with 2B4 in glycolipid-enriched microdomains of the plasma membrane, is a required intermediate for 2B4 signal transduction, and plays a role in 2B4-mediated cytotoxicity.PMID:12077228
adaptor proteins LAT and SLP-76 are involved in pre-BCR signaling, thereby rescuing arrested murine SLP-65(-/-) pre-B cellsPMID:12932362
The four distal tyrosines of this protein are required for signaling in FcepsilonRI-mediated mast cell activation.PMID:12953098
LAT is an essential regulator of T cell homeostasis and terminal differentiation.PMID:12970761
Vav1 transduces TCR signals to Ras by controlling recruitment of RasGRP1 to the membrane and recruitment of Sos1 and -2 to the transmembrane adapter protein LAT.PMID:14764585
LAT controls its own recruitment at the immune synapse, where it is required as a scaffold protein for the signalling machinery.PMID:14996932
LAT tyrosines differentially contribute to exocytosis and cytokine secretion and differentially regulate biological responses of mucosal- and serosal-type mast cells.PMID:15470052
The Lat does not completely ablate mast cells responsiveness.PMID:15745852
Mutation of the phospholipase C-gamma1-binding site of LAT affects both positive and negative thymocyte selection.PMID:15795236
Role of LAT in the development and function T cells. Review.PMID:16102570
mouse LAT mutant lacking palmitoylation was unstable and susceptible to degradation via the proteasome pathway.PMID:16460687
Polyclonal B cell activation in Lat(Y136F) mutant mice is not due to a direct (intrinsic) effect of the Lat mutation on B cells but indirectly results from the presence of CD4 Th2 effector cells.PMID:16887989
LAT mediates immunoglobulin E-induced sustained Erk activation critical for mast cell survival.PMID:17420272
activation of phospholipase C gamma 2 via glycoprotein 6 is dependent on 2 complementary eventsPMID:17579183
Despite the presence of autoantibodies causative of severe systemic disease, the pathological conditions observed in Lat(Y136F) mice unfold in an Ag-independent manner and thus do not qualify as a genuine autoimmune disorder.PMID:18209052
Overexpression of either Sp1 or full-length Sp3 was shown to augment LAT promoter activity, while siRNA-mediated knockdown of each transcription factor was demonstrated to have an inhibitory effect.PMID:18343609
GPVI-FcR gamma-chain, LAT and PLCgamma2 are essential for thrombus generation and stabilityPMID:18464161
These data show that natural killer cell immunoreceptor tyrosine-based activation motifs preferentially use a signaling cassette regulated by interplay between LAT and LAB.PMID:18645037
Gads plays a key role in linking the adapter LAT to SLP-76 in response to weak activation of GPVI and CLEC-2 whereas LAT is required for full activation over a wider range of agonist concentrations.PMID:18826392
Deletion of the STAT6 transcription factor converts the fulminant T helper(Th)2 cell lymphoproliferative disorder that characterizes LatY136F mice into a fast-onset lymphoproliferative disorder dominated by competent Th1 effectors and CD8 T cells.PMID:19234162
Supplementation with vitamin E eliminates the age-related differences in LAT phosphorylation in T cells from young and old.PMID:19403707
Results identify novel functions for both CD8 and LAT during CD8-mediated apoptosis that are independent of TCR signal transduction and suggest a mechanism for signal transduction leading to apoptosis upon CD8 crosslinking.PMID:19449311
LAT palmitoylation functions primarily as a sorting signal required for its plasma membrane transportPMID:19592663
Data show that Erk activation was diminished in LAT knock-in Bam32 knockout CD4(+) T cells.PMID:19667175
The fact that such LAT-independent signals result in lymphoproliferative disorders with excessive cytokine production demonstrates that LAT constitutes a key negative regulator of the triggering module.PMID:19682930
Results demonstrate a combined requirement for FcgammaRIII and FcgammaRIV in autoimmune injury, and identify the linker for activation of T cells adaptor as an integral component of linked FcgammaR and C5a activation to generate inflammation.PMID:19795417
Show
More
Hide
All
Subcellular Location
Cell membrane; Single-pass type III membrane protein. Note=Present in lipid rafts.