MSVCYRPPGNETLLSWKGSRATGTAFLLLAALLGLPGNGFVVWSLAGWRPTAGRPLAATL VLHLALADGAVLLLTPLFVAFLSQEAWPLGQVGCKAVYYVCALSMYASVLLTGLLSLQRC LAVTRPFLAPRLRSPALARRLLLGVWLAALVLAVPAAVYRHLWGGRVCQLCHPSPVHAAA HLSLETLTAFVLPFGTVLGCYGVTLARLRGARWGSGRQGTRVGRLVSAIVLAFGLLWAPY HAVNLLQAVAALAPPEGPLARLGGAGQAARAGTTALAFFSSSVNPVLYVFTAGDLLPRAG PRFLTRLFEGSGEARGGSRSREGTMELRTTPKLKVMGQGRGNGDPGGGDGGKTEKDSQEW
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Low-affinity receptor for leukotrienes including leukotriene B4. Mediates chemotaxis of granulocytes and macrophages. The response is mediated via G-proteins that activate a phosphatidylinositol-calcium second messenger system.
Gene References into Functions
FABP4 regulates the expression of BLT1R and its downstream signaling via control of oxidative stress in macrophagesPMID:28546450
This study demonstrates that LTB4 promotes macrophage phagocytosis of bacteria via BLT1, and that BLT2 can fulfill this role in the absence of BLPMID:28053185
the data show that the two leukotriene B4 receptors have opposing roles in the sensitization of peripheral sensory neurons forming a self-restricting system.PMID:28242764
These results show that 12-HHT/BLT2 enhances epithelial barrier function by increasing CLDN4 expression via the Galphai protein-p38 MAPK pathway.PMID:26527063
Data indicate that leukotriene B4 receptor 2 protein BLT2-deficient mice exhibited impaired re-epithelialization and delayed wound closure after skin punching.PMID:24821912
Findings indicate that BLT2 has a protective role in allergic airway inflammation and that diminished BLT2 expression in CD4(+) T cells may contribute to the pathophysiology of asthma.PMID:23603839
Selective inhibition of the BLT2 receptor in mice reduces the release of vascular reactive oxygen species and improves endothelial function in micePMID:21755457
Results suggest a direct anti-inflammatory role of BLT2 that is distinct from the proinflammatory roles of BLT1.PMID:20667973
our results suggest that the BLT2-Nox1-reactive oxygen species cascade is a previously unsuspected mediatory signaling mechanism to Th2 cytokine production in Ag-stimulated BMMCsPMID:20952677
BLT2-deficient mice develop normally; analysis of immune cells shows that disruption of BLT2 does not alter BLT1 expression or function.PMID:20656922
BLT2 plays a pivotal, mediatory role in the pathogenesis of asthma, acting through a "reactive oxygen species-NF-kappaB"-linked inflammatory signaling pathway.PMID:19448154
360 amino acid sequence determined and aligned with human sequencePMID:12895595
BLT2 is a leukotriene B4 receptor with a role in ERK activation and cell migration of primary mouse keratinocytesPMID:15866883
demonstrates expression of functional Leukotriene B4 receptors, both BLT1 and BLT2, in murine and human mast cells and a regulatory role for stem cell factor in their expressionPMID:16920986
12-HHT is a natural lipid agonist of BLT2 in vivo and induces chemotaxis of mast cellsPMID:18378794
The BLT2 receptor is involved in 12(S)-lipoxygenase-product-induced scratching in ICR mice.PMID:18536755