WTYHYSEKPMNWENARKFCKQNYTDLVAIQNKREIEYLENTLPKSPYYYWIGIRKIGKMWTWVGTNKTLTKEAENWGAGEPNNKKSKEDCVEIYIKRERDSGKWNDDACHKRKAALCYTASCQPGSCNGRGECVETINNHTCICDAGYYGPQCQYVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQETNRSFSKIKEGDYNPLFIPVAVMVTAFSGLAFLIWLARRLKKGKKSQERMDDPY
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Calcium-dependent lectin that mediates cell adhesion by binding to glycoproteins on neighboring cells. Mediates the adherence of lymphocytes to endothelial cells of high endothelial venules in peripheral lymph nodes. Promotes initial tethering and rolling of leukocytes in endothelia.
Gene References into Functions
data suggest that Ly6C(+)CD62L(+) infected monocytes served as a Trojan horse across the cerebral endothelium to induce brain infection. Therefore, CD62L should be considered as not only a temporally elicited antigen but also a disease-relevant leukocyte marker during the development of neurologic melioidosis.PMID:27646437
Myeloid-derived suppressor cell-induced L-selectin loss occurs through a contact-dependent, post-transcriptional mechanism that is independent of the major L-selectin sheddase, ADAM17, but results in significant elevation of circulating L-selectin in tumor-bearing mice.PMID:27929373
CD8(+) T-cells mediate ischemia reperfusion injury in a fatty liver through L-selectin.PMID:28543181
L-selectin is transported constitutively by the AP-1 complex, leading to the formation of a trans-Golgi network reserve pool; phosphorylation of the L-selectin tail blocks AP-1-dependent retrograde transport of L-selectinPMID:28235798
freeze and thaw of murine and human Tregs is associated with reduced expression of L-selectin (CD62L), which was previously established to be an important factor that contributes to the in vivo protective effects of TregsPMID:26693907
endothelial colony-forming cells interact with activated neutrophils via PSGL-1 and L-selectinPMID:24606340
These data indicate that L-selectin plays a major role in the development of C protein induced polymyositis, whereas ICAM-1 plays a lesser role, if any.PMID:24644046
Data suggest that modulation of P- and L-selectins may constitute a promising therapeutic approach.PMID:24177139
These results put into question the utility of CD62L as a predictive biomarker for the efficacy of ex vivo-expanded T cells after ACT in lymphopenic conditions.PMID:24218360
The PSGL-1-L-selectin complex-induced signaling effects on neutrophil slow rolling and recruitment in vivo demonstrate the functional importance of this pathway.PMID:24127491
L-selectin-dependent signalling - exploring the different signals that potentially arise from distinct phases of the multi-step adhesion cascade and the contribution of known binding partners of L-selectin in this responPMID:23299028
CD62L marks a mature natural killer (NK) cell subset by affecting the magnitude of the local NK cell response to adenovirus infection in the liver.PMID:23509354
Data indicate that naive lung CD4 cells supply the draining lymph nodes through a CD62L-independent, CCR7-dependent pathway.PMID:23319636
Signaling induced by ligation of L-selectin using mAb or endothelial cell-expressed ligand significantly enhanced the chemotaxis of murine T cells and B cells to SLC but not to other homeostatic chemokines.PMID:22387549
Pretreatment of cardiac mesoangioblasts with SDF-1 or transient expression of L-selectin induced a two- to three-fold increase in their transmigration and homing to the damaged heart.PMID:21869829
Hematopoietic lineage cells with Sca-1(high) expression and CD62L(neg/low) expression are characterized as multipotent progenitor cells, based on transient engraftment.PMID:21998453
the binding of L-selectin to its vascular and extravascular ligands is differentially regulated by pH.PMID:21982762
CD4 T cell co-stimulation with ICOS promotes the down-regulation of CCR7 and CD62L after activation, leading to a reduced return of activated CD4 T cells to the lymph nodes and a more efficient entry into the lungs.PMID:21421907
Data show a mechanism of control of CD62-L expression involving the miRNA let-7b.PMID:21768364
Atherosclerotic plaques did not exhibit any differences in cellular composition assessed by immunohistochemistry for CD68, CD3, CD4, and CD8 in ApoE(-/-)L-sel(-/-) as compared to ApoE(-/-) mice.PMID:21760899
migratory profile of CD62L-/- Tregs was that of an intermediate activated phenotype with higher expression of pro-inflammatory chemokine receptors compared to CD62LHi Tregs and much greater expression of CCR7 compared to CD62LLo Tregs.PMID:21070606
IL-7 drives Cdc25A-mediated T-cell proliferation, which prevents the nuclear translocation of Foxo1, leading to reduced expression of CD62L and the migration of T cells into circulation.PMID:20831893
In cultured cells and in mice, myeloid differentiation (MyD88)-dependent activation of B cells via Toll-like receptor TLR2 or TLR9 causes rapid loss of expression of CD62L by shedding caused by systemic infection with Salmonella typhimurium.PMID:20660707
Study suggests that L-selectin and ICAM-1 regulate Th2 and Th17 cell accumulation into the skin and lung, leading to the development of fibrosis.PMID:20624949
Division-linked differentiation predicts the differences in proportion of cells CD62L(high) observed between responses of different adoptive transfer number and within individual mice.PMID:19859082
lymphoma cells are the major contributors to levels of soluble forms of L-selectins in lymphoma-bearing micePMID:20001233
Auditory stress enhances contact hypersensitivity (CH) response and that the augmentation of this CH response might be mediated through L-selectin, but not through P- or E-selectin pathways.PMID:19948832
Our data indicate a critical role for CD62L and lymph node homing for the process of homeostatic proliferationPMID:19658092
the role of L-selectin in induction of alloantigen-specific tolerancePMID:11823485
required for recruitment of dendritic cells to lymph nodes during mouse mammary tumor virus infectionPMID:11830477
Surprisingly, L-selectin expressed on endogenous leukocytes also facilitates metastasis in both the syngeneic and xenogeneic (T and B lymphocyte deficient) systemsPMID:11854515
CD62L expression is not essential for the development of T cell-mediated type 1 diabetes in NOD mice.PMID:11884430
L-selectin contributes to immune complex-induced skin injury cooperatively with ICAM-1 by regulating the accumulation of neutrophils and mast cells.PMID:11884469
L-selectin dimerization enhances tether formation to properly spaced ligand.PMID:11907045
Heparin's anti-inflammatory effects require glucosamine 6-O-sulfation and are mediated by blockade of L- and P-selectins.PMID:12093896
influences lymphocyte migration in vivo and increased levels present in certain pathologic conditions may adversely affect leukocyte migrationPMID:12165530
CD62L expression is necessary for the diabetes-delaying effect of transfer of CD4+CD25+ splenocytes in vivo, but not for their suppressor function in vitro.PMID:12193715
Culture-activated T cells with the CD62 L-selectin(low) phenotype have potent antitumor activity and memory in vitro and in vivo and when adoptively transferred can eliminate advanced pulmonary metastases and cure subcutaneous tumors.PMID:12218152
L-selectin is involved in the P- and E-selectin-independent migration of cytotoxic T lymphocytes into inflamed skin.PMID:12370362
L-selectin regulates pulmonary fibrosis by mediating the accumulation of leukocytes.PMID:12414509
Loss of nasal passage and reproductive tract immunity in L-selectin-deficient mice at 16 days postprimary intranasal immunization with cholera toxin is due to delay of L-selectin(low)/alpha4beta7 integrin (double- low) B cells entering these sites.PMID:12421944
L-selectin cooperatively with ICAM-1 regulates induction of the immediate-type hypersensitivity response by mediating mast cell accumulation into inflammatory sites.PMID:12682269
L-selectin/PNAd, alpha4beta1 integrin/VCAM-1, and LFA-1, targets specific lymphocyte subsets to BALT.PMID:12756264
leukocyte-expressed PSGL-1 serves as the main L-selectin ligand in inflamed postcapillary venules.PMID:12756271
Data suggest that Trousseau syndrome is likely triggered by interactions of circulating carcinoma mucins with leukocyte L-selectin and platelet P-selectin without requiring accompanying thrombin generation.PMID:12975470
L-selectin shedding from antigen-activated T cells prevents reentry into peripheral lymph nodesPMID:14597735
In a chronic ileitis model, pathogenic CD4+ T cells alternatively engage L-selectin in order to recirculate to the chronically inflamed small intestine.PMID:15699171
L-selectin has a role in the growth of thymic lymphomaPMID:15705798
leukocytes can continue to roll in the absence of optimal P-selectin/PSGL-1 interaction using an alternative mechanism that involves P-selectin-, L-selectin-, and sLe(x)-bearing ligandsPMID:15743805
preferential migration of CD62L+CD4+ cells into the appendix as compared to the colonPMID:15905618
Show
More
Hide
All
Subcellular Location
Cell membrane; Single-pass type I membrane protein.