Recombinant Mouse Junctional adhesion molecule A (F11r)

Code: CSB-CF007917MO
Size:
20μg
20μg100μg
US$4545
Quantity:
Express system: in vitro E.coli expression system
Species: Mus musculus (Mouse)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
F11r
Uniprot NO.
Alternative Names
F11r; Jam1; Jcam; Jcam1; Junctional adhesion molecule A; JAM-A; Junctional adhesion molecule 1; JAM-1; CD antigen CD321
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
27-300
Target Protein Sequence
KGSVYTAQSDVQVPENESIKLTCTYSGFSSPRVEWKFVQGSTTALVCYNSQITAPYADRVTFSSSGITFSSVTRKDNGEYTCMVSEEGGQNYGEVSIHLTVLVPPSKPTISVPSSVTIGNRAVLTCSEHDGSPPSEYSWFKDGISMLTADAKKTRAFMNSSFTIDPKSGDLIFDPVTAFDSGEYYCQAQNGYGTAMRSEAAHMDAVELNVGGIVAAVLVTLILLGLLIFGVWFAYSRGYFERTKKGTAPGKKVIYSQPSTRSEGEFKQTSSFLV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Seems to play a role in epithelial tight junction formation. Appears early in primordial forms of cell junctions and recruits PARD3. The association of the PARD6-PARD3 complex may prevent the interaction of PARD3 with JAM1, thereby preventing tight junction assembly. Plays a role in regulating monocyte transmigration involved in integrity of epithelial barrier. Ligand for integrin alpha-L/beta-2 involved in memory T-cell and neutrophil transmigration. Involved in platelet activation.
Gene References into Functions
  1. Deletion JAM-A from platelets increases early-stage neointima formation after carotid artery wire injury in hyperlipidemic mice. PMID:28211187
  2. JAM-A is present in the prostate and seminal vesicles and in all three regions of the epididymis where it is secreted in epididymosomes in the luminal fluid and can be delivered to sperm. PMID:28062807
  3. Soluble JAM-A secreted from cardiac progenitor cells reduces infiltration of neutrophils after myocardial infarction and ameliorates tissue damage through prevention of excess inflammation. PMID:25468657
  4. JAM-A up-regulation can increase the proliferation, cytokine secretion and wound-homing ability of MSCs, thus accelerating the repair rate of full-thickness skin defects PMID:25994236
  5. Endothelial JAM-A but not hematopoietic JAM-A facilitates reovirus T1L bloodstream entry and egress. PMID:25149763
  6. Deletion of JAM-A causes a gain-of-function in platelets, with lower activation thresholds and increased inflammatory activities. This leads to an increase of plaque formation, particularly in early stages of the disease. PMID:25472975
  7. The F11r gene is directly regulated by retinoic acid in the embryonic mesoderm. PMID:25251699
  8. Redistribution of JAM-A in endothelial cells after stimulation with pro-atherogenic oxidized lipoproteins results in increased transmigration of mononuclear cells. PMID:24704627
  9. JAM-A has a prominent role in regulating leukocyte infiltration after brain I/R injury and could be a new target in limiting post-ischemic inflammation. PMID:24657919
  10. JAM-A regulates epithelial permeability via association with ZO-2, afadin, and PDZ-GEF1 to activate Rap2c and control contraction of the apical cytoskeleton. PMID:23885123
  11. Cancer stem cells selectively express JAM-A, which regulates self-renewal. PMID:24373972
  12. These studies establish F11R as a novel monocyte prognostic marker for GBM critical for defining a subpopulation of stromal cells for future potential therapeutic intervention. PMID:24147027
  13. Our data identify endothelial JAM-A as an important effector molecule integrating atherogenic conditions to direct inflammatory cell entry at predilection sites of atherosclerosis. PMID:24065611
  14. The JAM-A and ZO-1 genes were highly expressed in all the tested tissues. PMID:23568966
  15. Junctional adhesion molecule-A regulates vascular endothelial growth factor receptor-2 signaling-dependent mouse corneal wound healing. PMID:23667656
  16. The crucial role of JAM-A in the transmigration of neutrophils from the vasculature into inflamed tissues. PMID:22904169
  17. The chemokine (C-C motif) ligand 2 (CCL2) induced JAM-A redistribution from the interendothelial cell area to the apical surface of brain endothelial cells. PMID:22733993
  18. CASK negatively regulates PMCA4b by directly binding to it and JAM-A positively regulates it indirectly through CASK PMID:22020416
  19. JAM-A normally limits platelet accumulation by inhibiting integrin outside-in signaling thus preventing premature platelet activation. PMID:22271446
  20. Data suggest that aPKC phosphorylates JAM-A at S285 to regulate cell-cell contact maturation, TJ formation, and single lumen specification. PMID:22371556
  21. downregulation of JAM-A reduces tumor aggressive behavior by increasing cell susceptibility to apoptosis PMID:21695058
  22. Data demenstrate that JAM-A restricts intestinal epithelial cell (IEC) proliferation in a dimerization-dependent manner, by inhibiting Akt-dependent beta-catenin activation. PMID:21372850
  23. Our data show that JAM-A is a novel surface marker for NG2-glia cells of the adult brain. PMID:20184779
  24. In the Rip1Tag2 tumor model, abrogation of JAM-A reduces cancer development by increasing antitumor immune response. PMID:20160037
  25. JAM-1 did not contribute to global embryo compaction and adhesion but rather regulated the timing of blastocoel cavity formation dependent upon establishment of the trophectoderm tight junction paracellular seal. PMID:15494378
  26. By regulating cytoskeletal and adhesive structures, JAM-A expression prevents cell motility, probably in a PSD95-Dlg-ZO1-dependent manner. PMID:15657074
  27. JAM-A is up-regulated in hepatic venules and serves as an endothelial receptor of neutrophil transmigration, but it does not mediate leukocyte rolling, adhesion, or platelet-endothelial cell interactions. PMID:15827135
  28. JAM-A is required for the correct infiltration of polymorphonuclear leukocytes into an inflamed peritoneum or in the heart upon ischemia-reperfusion injury. PMID:16027360
  29. crucial role of JAM-A in accelerated lesion formation and monocyte infiltration in atherosclerosis-prone mice PMID:16306427
  30. Taken together, these data indicate that JAM-A regulates cell motility by cooperating with microtubule-stabilizing pathways. PMID:16783819
  31. Essential role for JAM-A in FGF-2-induced angiogenesis. PMID:16809549
  32. JAM-A is expressed in the corneal epithelium where it appears to regulate cell shape. PMID:17118692
  33. Junctional adhesion molecule-A is critical for the formation of pseudocanaliculi and modulates E-cadherin expression in hepatic cells PMID:17623668
  34. JAM-A is expressed on hematopoietic precursors in various hematopoietic tissues PMID:17986666
  35. The findings show that JAM-A is involved in sperm tail formation and is essential for normal motility, which may occur via its signal transduction and protein phosphorylation properties. PMID:18022613
  36. JAM-A plays a role in intestinal homeostasis by regulating epithelial permeability, inflammation, and proliferation PMID:18039951
  37. A short bond lifetime imparts a highly dynamic nature to homophilic JAM-A interactions for regulating tight junction permeability while stable interactions between sigma1 and JAM-A likely anchor the virus to the cell surface and facilitate viral entry. PMID:18446885
  38. nonredundant and novel role of JAM-A in controlling mucosal homeostasis by regulating the integrity and permeability of epithelial barrier function PMID:18514073
  39. Nectin plays a novel role in the co-localization of JAM and claudin at the same cell-cell adhesion membrane domains. PMID:18547333
  40. These data indicate that JAM-A is required for the correct internalization and recycling of integrins during cell migration. PMID:19118219
  41. The authors inoculated wild-type (WT) and isogenic JAM-A(-/-) mice perorally with reovirus and found that JAM-A is dispensable for viral replication in the intestine but required for systemic dissemination. PMID:19154988

Show More

Hide All

Subcellular Location
Cell junction, tight junction. Cell membrane; Single-pass type I membrane protein. Note=Localized at tight junctions of both epithelial and endothelial cells.
Protein Families
Immunoglobulin superfamily
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products