KGSVYTAQSDVQVPENESIKLTCTYSGFSSPRVEWKFVQGSTTALVCYNSQITAPYADRVTFSSSGITFSSVTRKDNGEYTCMVSEEGGQNYGEVSIHLTVLVPPSKPTISVPSSVTIGNRAVLTCSEHDGSPPSEYSWFKDGISMLTADAKKTRAFMNSSFTIDPKSGDLIFDPVTAFDSGEYYCQAQNGYGTAMRSEAAHMDAVELNVGGIVAAVLVTLILLGLLIFGVWFAYSRGYFERTKKGTAPGKKVIYSQPSTRSEGEFKQTSSFLV
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Seems to play a role in epithelial tight junction formation. Appears early in primordial forms of cell junctions and recruits PARD3. The association of the PARD6-PARD3 complex may prevent the interaction of PARD3 with JAM1, thereby preventing tight junction assembly. Plays a role in regulating monocyte transmigration involved in integrity of epithelial barrier. Ligand for integrin alpha-L/beta-2 involved in memory T-cell and neutrophil transmigration. Involved in platelet activation.
Gene References into Functions
Deletion JAM-A from platelets increases early-stage neointima formation after carotid artery wire injury in hyperlipidemic mice.PMID:28211187
JAM-A is present in the prostate and seminal vesicles and in all three regions of the epididymis where it is secreted in epididymosomes in the luminal fluid and can be delivered to sperm.PMID:28062807
Soluble JAM-A secreted from cardiac progenitor cells reduces infiltration of neutrophils after myocardial infarction and ameliorates tissue damage through prevention of excess inflammation.PMID:25468657
JAM-A up-regulation can increase the proliferation, cytokine secretion and wound-homing ability of MSCs, thus accelerating the repair rate of full-thickness skin defectsPMID:25994236
Endothelial JAM-A but not hematopoietic JAM-A facilitates reovirus T1L bloodstream entry and egress.PMID:25149763
Deletion of JAM-A causes a gain-of-function in platelets, with lower activation thresholds and increased inflammatory activities. This leads to an increase of plaque formation, particularly in early stages of the disease.PMID:25472975
The F11r gene is directly regulated by retinoic acid in the embryonic mesoderm.PMID:25251699
Redistribution of JAM-A in endothelial cells after stimulation with pro-atherogenic oxidized lipoproteins results in increased transmigration of mononuclear cells.PMID:24704627
JAM-A has a prominent role in regulating leukocyte infiltration after brain I/R injury and could be a new target in limiting post-ischemic inflammation.PMID:24657919
JAM-A regulates epithelial permeability via association with ZO-2, afadin, and PDZ-GEF1 to activate Rap2c and control contraction of the apical cytoskeleton.PMID:23885123
Cancer stem cells selectively express JAM-A, which regulates self-renewal.PMID:24373972
These studies establish F11R as a novel monocyte prognostic marker for GBM critical for defining a subpopulation of stromal cells for future potential therapeutic intervention.PMID:24147027
Our data identify endothelial JAM-A as an important effector molecule integrating atherogenic conditions to direct inflammatory cell entry at predilection sites of atherosclerosis.PMID:24065611
The JAM-A and ZO-1 genes were highly expressed in all the tested tissues.PMID:23568966
The crucial role of JAM-A in the transmigration of neutrophils from the vasculature into inflamed tissues.PMID:22904169
The chemokine (C-C motif) ligand 2 (CCL2) induced JAM-A redistribution from the interendothelial cell area to the apical surface of brain endothelial cells.PMID:22733993
CASK negatively regulates PMCA4b by directly binding to it and JAM-A positively regulates it indirectly through CASKPMID:22020416
Data suggest that aPKC phosphorylates JAM-A at S285 to regulate cell-cell contact maturation, TJ formation, and single lumen specification.PMID:22371556
downregulation of JAM-A reduces tumor aggressive behavior by increasing cell susceptibility to apoptosisPMID:21695058
Data demenstrate that JAM-A restricts intestinal epithelial cell (IEC) proliferation in a dimerization-dependent manner, by inhibiting Akt-dependent beta-catenin activation.PMID:21372850
Our data show that JAM-A is a novel surface marker for NG2-glia cells of the adult brain.PMID:20184779
In the Rip1Tag2 tumor model, abrogation of JAM-A reduces cancer development by increasing antitumor immune response.PMID:20160037
JAM-1 did not contribute to global embryo compaction and adhesion but rather regulated the timing of blastocoel cavity formation dependent upon establishment of the trophectoderm tight junction paracellular seal.PMID:15494378
By regulating cytoskeletal and adhesive structures, JAM-A expression prevents cell motility, probably in a PSD95-Dlg-ZO1-dependent manner.PMID:15657074
JAM-A is up-regulated in hepatic venules and serves as an endothelial receptor of neutrophil transmigration, but it does not mediate leukocyte rolling, adhesion, or platelet-endothelial cell interactions.PMID:15827135
JAM-A is required for the correct infiltration of polymorphonuclear leukocytes into an inflamed peritoneum or in the heart upon ischemia-reperfusion injury.PMID:16027360
crucial role of JAM-A in accelerated lesion formation and monocyte infiltration in atherosclerosis-prone micePMID:16306427
Taken together, these data indicate that JAM-A regulates cell motility by cooperating with microtubule-stabilizing pathways.PMID:16783819
Essential role for JAM-A in FGF-2-induced angiogenesis.PMID:16809549
JAM-A is expressed in the corneal epithelium where it appears to regulate cell shape.PMID:17118692
Junctional adhesion molecule-A is critical for the formation of pseudocanaliculi and modulates E-cadherin expression in hepatic cellsPMID:17623668
JAM-A is expressed on hematopoietic precursors in various hematopoietic tissuesPMID:17986666
The findings show that JAM-A is involved in sperm tail formation and is essential for normal motility, which may occur via its signal transduction and protein phosphorylation properties.PMID:18022613
JAM-A plays a role in intestinal homeostasis by regulating epithelial permeability, inflammation, and proliferationPMID:18039951
A short bond lifetime imparts a highly dynamic nature to homophilic JAM-A interactions for regulating tight junction permeability while stable interactions between sigma1 and JAM-A likely anchor the virus to the cell surface and facilitate viral entry.PMID:18446885
nonredundant and novel role of JAM-A in controlling mucosal homeostasis by regulating the integrity and permeability of epithelial barrier functionPMID:18514073
Nectin plays a novel role in the co-localization of JAM and claudin at the same cell-cell adhesion membrane domains.PMID:18547333
These data indicate that JAM-A is required for the correct internalization and recycling of integrins during cell migration.PMID:19118219
The authors inoculated wild-type (WT) and isogenic JAM-A(-/-) mice perorally with reovirus and found that JAM-A is dispensable for viral replication in the intestine but required for systemic dissemination.PMID:19154988
Show
More
Hide
All
Subcellular Location
Cell junction, tight junction. Cell membrane; Single-pass type I membrane protein. Note=Localized at tight junctions of both epithelial and endothelial cells.