Home
Product
Protein
Transmembrane Proteins
Recombinant Mouse Interleukin-5 receptor subunit alpha (Il5ra)

Recombinant Mouse Interleukin-5 receptor subunit alpha (Il5ra)

Code: CSB-CF011663MO

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5473

Quantity:

Express system: in vitro E.coli expression system

Species: Mus musculus (Mouse)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Il5ra

Uniprot NO.

P21183

Alternative Names

Il5ra; Il5r; Interleukin-5 receptor subunit alpha; IL-5 receptor subunit alpha; IL-5R subunit alpha; IL-5R-alpha; IL-5RA; CD antigen CD125

Species

Mus musculus (Mouse)

Source

in vitro E.coli expression system

Expression Region

18-415

Target Protein Sequence

DLLNHKKFLLLPPVNFTIKATGLAQVLLHWDPNPDQEQRHVDLEYHVKINAPQEDEYDTRKTESKCVTPLHEGFAASVRTILKSSHTTLASSWVSAELKAPPGSPGTSVTNLTCTTHTVVSSHTHLRPYQVSLRCTWLVGKDAPEDTQYFLYYRFGVLTEKCQEYSRDALNRNTACWFPRTFINSKGFEQLAVHINGSSKRAAIKPFDQLFSPLAIDQVNPPRNVTVEIESNSLYIQWEKPLSAFPDHCFNYELKIYNTKNGHIQKEKLIANKFISKIDDVSTYSIQVRAAVSSPCRMPGRWGEWSQPIYVGKERKSLVEWHLIVLPTAACFVLLIFSLICRVCHLWTRLFPPVPAPKSNIKDLPVVTEYEKPSNETKIEVVHCVEEVGFEVMGNSTF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

This is the receptor for interleukin-5. The alpha chain binds to IL5.

Gene References into Functions

SLy2 controls the antibody response to pneumococcal vaccine through an IL-5Ralpha-dependent mechanism in B-1 cells. PMID:25330943
Deglycosylated variant Il5ralpha has the same ligand binding affinity and biological activity as fully glycosylated IL5Ralpha, thus demonstrating a unique role for Asn196 glycosylation in IL5Ralpha function. PMID:21770429
Interleukin-5 receptor alpha chain expression and splicing during brain development in mice. PMID:11811788
Octamer Transcription Factor 2 (Oct2) augments the ability of activated B cells to differentiate to antibody-secreting plasma cells under T cell-dependent conditions through regulation of the gene encoding the interleukin 5 receptor alpha chain. PMID:18250192
We identified B-1 progenitors expressing low levels of IL-5 receptor alpha chain (IL-5Ralpha) and eosinophil progenitors expressing higher levels of IL-5Ralpha in the fetal liver PMID:19428566
The murine interleukin-5 receptor alpha chain pre-mRNA is alternatively spliced, resulting in soluble isoforms lacking the transmembrane coding region which do not complex with the IL-5R beta chain. PMID:11425312