Home
Product
Protein
Transmembrane Proteins
Recombinant Mouse Interleukin-3 receptor subunit alpha (Il3ra)

Recombinant Mouse Interleukin-3 receptor subunit alpha (Il3ra)

Code: CSB-CF011658MO

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5338

Quantity:

Express system: in vitro E.coli expression system

Species: Mus musculus (Mouse)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Il3ra

Uniprot NO.

P26952

Alternative Names

Il3ra; Sut-1; Interleukin-3 receptor subunit alpha; IL-3 receptor subunit alpha; IL-3R subunit alpha; IL-3R-alpha; IL-3RA; Interleukin-3 receptor class II alpha chain; CD antigen CD123

Species

Mus musculus (Mouse)

Source

in vitro E.coli expression system

Expression Region

17-396

Target Protein Sequence

SDLAAVREAPPTAVTTPIQNLHIDPAHYTLSWDPAPGADITTGAFCRKGRDIFVWADPGLARCSFQSLSLCHVTNFTVFLGKDRAVAGSIQFPPDDDGDHEAAAQDLRCWVHEGQLSCQWERGPKATGDVHYRMFWRDVRLGPAHNRECPHYHSLDVNTAGPAPHGGHEGCTLDLDTVLGSTPNSPDLVPQVTITVNGSGRAGPVPCMDNTVDLQRAEVLAPPTLTVECNGSEAHARWVARNRFHHGLLGYTLQVNQSSRSEPQEYNVSIPHFWVPNAGAISFRVKSRSEVYPRKLSSWSEAWGLVCPPEVMPVKTALVTSVATVLGAGLVAAGLLLWWRKSLLYRLCPPIPRLRLPLAGEMVVWEPALEDCEVTPVTDA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

In mouse, there are two classes of high-affinity IL3 receptors. One contains an IL3-specific beta subunit and the other contains the beta subunit also shared by high-affinity IL5 and GM-CSF receptors.

Gene References into Functions

expression of the interleukin 3 receptor alpha (Il3ra also known as Cd123) subunit is dependent on Jmjd2/Kdm4 through a mechanism involving removal of H3K9me3 from the promoter of the Il3ra gene. PMID:27257215
Data indicate that the proliferative and differentiative effect of saponins from Sanguisorba officinalis (DYS) on megakaryocyte progenitor cells is correlated to the up-regulation of IL-3 receptor and c-kit expression. PMID:25095385
Findings indicate that SLP-76 is an essential signaling component for basophil activation downstream of both FcepsilonRI and the IL-3 receptor. PMID:22875843
Interleukin-3/dendritic cells expressed higher levels of interleukin-3 receptor. PMID:12880419

Hide All

Subcellular Location

[Isoform 1]: Cell membrane; Single-pass type I membrane protein. Note=Expressed on the cell surface.; [Isoform 2]: Endomembrane system; Single-pass type I membrane protein. Note=Mostly distributed inside the cells, except in the nuclei and is not transported to the cell surface.

Protein Families

Type I cytokine receptor family, Type 5 subfamily

Database Links

UNIGENE: Mm.425857

KEGG: mmu:16188

STRING: 10090.ENSMUSP00000088079

Promotions