Recombinant Mouse Interleukin-23 subunit alpha (Il23a)

Code: CSB-CF863641MOd7
Size:
20ug
20ug100ug
US$878
Quantity:
Express system: in vitro E.coli expression system
Species: Mus musculus (Mouse)
Tag Info: C-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Mouse Il23a protein
Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Il23a
Uniprot NO.
Alternative Names
Il23a; Interleukin-23 subunit alpha; IL-23 subunit alpha; IL-23-A; Interleukin-23 subunit p19; IL-23p19
Research Area
Immunology
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
22-196aa
Target Protein Sequence
VPRSSSPDWAQCQQLSRNLCMLAWNAHAPAGHMNLLREEEDEETKNNVPRIQCEDGCDPQGLKDNSQFCLQRIRQGLAFYKHLLDSDIFKGEPALLPDSPMEQLHTSLLGLSQLLQPEDHPRETQQMPSLSSSQQWQRPLLRSKILRSLQAFLAIAARVFAHGAATLTEPLVPTA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
22.9 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Associates with IL12B to form the IL-23 interleukin, a heterodimeric cytokine which functions in innate and adaptive immunity. IL-23 may constitute with IL-17 an acute response to infection in peripheral tissues. IL-23 binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activates the Jak-Stat signaling cascade, stimulates memory rather than naive T-cells and promotes production of proinflammatory cytokines. IL-23 induces autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis.
Gene References into Functions
  1. JunB has an essential role in IL-23-dependent pathogenicity of Th17 cells PMID:28555647
  2. HO-1 enhanced STAT3 phosphorylation, which enriched to Il12b and Il23a loci and negatively regulated their transcription. These findings demonstrate the underlying mechanism through which a nutritional can interfere with the immune response. CUR silences IL-23/Th17-mediated pathology by enhancing HO-1/STAT3 interaction in dendritic cells. PMID:28290522
  3. This study defines a critical IL-36/IL-23/IL-22 cytokine network instrumental for antimicrobial peptide production and host defense in intestinal mucosa damage using a mouse inflammatory bowel disease model. PMID:29760082
  4. IL-23 drives differentiation of peripheral gamma-delta 17 T cells from adult bone marrow-derived precursors. PMID:28855306
  5. In mice on a C57BL/6 background, neither IL-23p19 nor IL-17A plays a role for immune protection against L. major in the physiological context of natural infections. PMID:27297018
  6. The hormone levels are significantly reduced and lymphocytic infiltration in the lacrimal gland in ovariectomized mice, whereas the frequency of Th17 cells in the blood and spleen and IL-17A and IL-23 expression in the lacrimal glands are increased, leading to reduced tear production and positive fluorescein staining in the cornea. PMID:27341090
  7. this study unveiled the role of IL-23-dependent IL-17 induction in LdCen-/- parasite-induced immunity and subsequent protection against visceral leishmaniasis PMID:29187586
  8. Results reveal the importance of the IL-23/IL-17 inflammatory axis in secondary brain injury after intracerebral hemorrhage. PMID:27729335
  9. RIG-I expression is markedly increased in the affected skin derived from psoriasis patients and from both IL-23- and imiquimod -induced psoriasis-like mouse model. PMID:28377495
  10. results show that IL-23 accounts for the main aspects of human and murine lupus including the expansion of double negative T cells, decreased IL-2, and increased IL-17 production PMID:28646040
  11. this study shows that IL-23 but not IL-1 contributes to the IL-17A expression induced by subacute O3 exposure PMID:27043160
  12. IL-23 released by keratinocytes in response to endogenous TLR4 ligands causes skin DCs, which selectively express IL-23R, to up-regulate their endogenous IL-23 production and drive an IL-22 response in naive CD4(+) T cells that mediates epidermal thickening. PMID:27551155
  13. In mice overexpressing IL23, enthesis-resident gamma/delta T cells accumulate in the enthesis, ciliary body, and aortic valve. PMID:27111864
  14. we describe here a new IL-12 member IL-39 (IL-23p19/Ebi3) secreted by activated B cells that mediate inflammatory responses in lupus-like mice. Thus, IL-39 might contribute to immunopathogenic mechanisms of SLE. PMID:27019190
  15. These data identify the important contributions of IL-23 to the development of elastase-induced pulmonary inflammation and emphysema. PMID:27351934
  16. The inflammatory phenotype in barrier-defective skin is shaped by counterregulation between the TSLP/type 2 and IL-23/type 17 axes. PMID:26993035
  17. IL-23 is another important bronchial epithelial cell-driven cytokine which may contribute to the development of house dust mite allergic sensitization and asthma. PMID:27864285
  18. this study shows that elevated iserum IL-23 is associated with mortality in lipopolysaccharide/d-galactosamine -induced acute liver injury, and that IL-23 neutralizing antibodies attenuated liver injury by reducing the expression of Th17-related inflammatory cytokines, neutrophil chemoattractants and stabilization factors within the liver tissue PMID:28282579
  19. IL-23 is a considerable molecular in tumor progression, which simultaneously facilitates processes of pro-tumor inflammation, such as angiogenesis, immunosuppressive cytokines as well as infiltrations of M2 macrophages and neutrophils, and suppresses antitumor immune responses through reduction of CD4(+) T cells and CD8(+) T cells PMID:27956175
  20. this study shows that that IL-23 signaling is required for monocyte recruitment during Clostridium difficile colitis PMID:27995603
  21. data suggest that systemic IL-23/STAT3 axis is responsible for enhanced airway inflammation during psoriasis PMID:27984001
  22. this study shows that madecassoside ointment ameliorates imiquimod-induced skin inflammation and abnormal keratinocyte proliferation by regulating the IL-23/IL-17 axis PMID:27540765
  23. this study shows that IL-18, cooperatively with IL-23, induced prominent inflammation and enhanced psoriasis-like epidermal hyperplasia PMID:28299442
  24. The IL-23/IL-17 axis plays a critical role in the immunopathology of hepatic amebiasis. IL-13 secreted by CD11b(+)Ly6C(lo) monocytes may be associated with recovery from liver damage. PMID:26809113
  25. CD11c(+) monocyte/macrophages promote chronic Helicobacter hepaticus-induced intestinal inflammation through the production of IL-23. PMID:26242598
  26. These results suggest that Il23a expression in DCs is synergistically triggered by the PG E2-EP4-cAMP-PKA pathway and canonical/non-canonical NF-kappaB pathways and CREB activated by CD40 stimulation. PMID:26189370
  27. IL-23-induced GM-CSF mediates the pathogenicity of CD4(+) T cells in experimental autoimmune myocarditis. PMID:26660726
  28. Endogenous IL-23 production at the site of antigen sensitization facilitates type-2 immune responses, whereas IL-23 production and subsequent IL-17A synthesis in the airways suppresses allergic inflammation. PMID:26344076
  29. IL-23, but not IL-17a or IL-22, promotes neutrophil recruitment and inflammatory cytokine and chemokine expression in the colon in response to C. difficile infection. PMID:26455347
  30. IL-23/IL-1/IFNgamma/TNFalpha/T-bet/Eomesodermin-driven circuit drives GM-CSF/IFNgamma-producing Th17 cell development PMID:26511769
  31. This study showed thatIL-23 is significantly increased in infected mice with a myeloid cell-specific deletion of IL-10, and the addition of IL-10 reduces IL-23 production by intestinal macrophages. PMID:25959063
  32. Both IL-23 and isolated lymphoid follicles are associated with inflammatory bowel disease, suggesting that disruption to this pathway may have an important role in the breakdown of microbiota-immune homeostasis. PMID:25249168
  33. The data define a novel pathway that is used by IL-23 in myeloid cells and identify a major mechanism for the stimulation of osteoclastogenesis in inflammatory arthritis. PMID:25452564
  34. IL-23-mediated mononuclear phagocyte crosstalk protects mice from Citrobacter rodentium-induced colon immunopathology. PMID:25761673
  35. p19 inhibition decreased IL-17A+IFN-g+ double-positive T cells in the colon to almost naive quantities. PMID:26431947
  36. Data indicate that sensory neurons directly sense Candida albicans and augment interleukin 23 (IL-23) production. PMID:26377898
  37. Results confirm that IL-23p19 gene knockdown efficiently suppresses the IL-23/IL-17 axis, decreases the IL-17/IFN-gamma ratio and promotes Foxp3 expression, eventually improving the outcomes of later cerebral ischemia PMID:25637493
  38. Data show the contribution of IL-23/IL-23 receptor and IL-7/IL-7 receptor signaling in Th17 and Th1 cell dynamics during experimental autoimmune encephalomyelitis (EAE). PMID:26223651
  39. that IL-23, but not IL-17 is crucial for the development of OVA-induced AR PMID:26239416
  40. Study provides evidence that IL-23/IL-23R plays a critical role in brain ischemic injury PMID:25600958
  41. Interleukin-23 production by the thymic dendritic cells promotes apoptosis of the CD4(hi)CD8(hi) double-positive thymocytes. PMID:25001511
  42. Our results reveal a novel role for the IL-23-ILC3s axis in the pathogenesis of neonatal intestinal inflammation. PMID:25160819
  43. Results suggest that increased activation of the IL-23/IL-17 pathway has detrimental effects on sepsis-induced lung inflammation. PMID:24978886
  44. the role of IL-23 in Francisella tularensis LVS resistance PMID:25296161
  45. Knocking down the expression of MMP2 in melanoma cells resulted in inhibition of IL-23-induced invasiveness PMID:25639230
  46. Expression of the p19 and p40 subunits of IL-23, a c-Rel-dependent cytokine, was enhanced in p100-deficient cells, although expression of a RelA-dependent cytokine, TNF-alpha, was reduced PMID:25305492
  47. The action of GM-CSF that promotes advanced plaque progression is mediated by interleukin-23-inducing activity. PMID:25348165
  48. The IL-23 was required for the development of a Chlamydia-specific Th17 response in the lymph nodes and for production of IL-22 and IL-17 in the genital tract. PMID:24238108
  49. suggest that Hmgb1-IL-23-IL-17-IL-6-Stat3 axis plays a pivotal role in tumor development in murine models of melanoma PMID:24453427
  50. In response to systemic beta-1,3-glucan, intestinal IL-23 provokes local mucosal dysregulation and cytokines driving the spondyloarthritis syndrome, including IL-17/IL-22-dependent enthesitis. PMID:24664521

Show More

Hide All

Subcellular Location
Secreted. Note=Secreted upon association with IL12B.
Protein Families
IL-6 superfamily
Tissue Specificity
Secreted by activated dendritic cells (at protein level). Detected in various tissues with higher expression in polarized Th1 cells and activated macrophages.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products