Home
Product
Protein
Transmembrane Proteins
Recombinant Mouse Interferon-induced transmembrane protein 1 (Ifitm1)

Recombinant Mouse Interferon-induced transmembrane protein 1 (Ifitm1)

Code: CSB-CF863485MO

Rate （N/A）
Review （0）

Size:

20μg100μg

US$3288

Quantity:

Express system: in vitro E.coli expression system

Species: Mus musculus (Mouse)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Ifitm1

Uniprot NO.

Q9D103

Species

Mus musculus (Mouse)

Source

in vitro E.coli expression system

Expression Region

1-106

Target Protein Sequence

MPKEQQEVVVLGSPHISTSATATTINMPEISTPDHVVWSLFNTLFMNFCCLGFVAYAYSV KSRDRKMVGDTTGAQAFASTAKCLNISSLFFTILTAIVVIVVCAIR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

IFN-induced antiviral protein which inhibits the entry of viruses to the host cell cytoplasm, permitting endocytosis, but preventing subsequent viral fusion and release of viral contents into the cytosol. Active against multiple viruses, including influenza A virus, SARS coronavirus (SARS-CoV), Marburg virus (MARV), Ebola virus (EBOV), Dengue virus (DNV) and West Nile virus (WNV). Can inhibit: influenza virus hemagglutinin protein-mediated viral entry, MARV and EBOV GP1,2-mediated viral entry and SARS-CoV S protein-mediated viral entry. Also implicated in cell adhesion and control of cell growth and migration. Plays a key role in the antiproliferative action of IFN-gamma either by inhibiting the ERK activation or by arresting cell growth in G1 phase in a p53-dependent manner. Acts as a positive regulator of osteoblast differentiation.

Gene References into Functions

Age-related onset of obesity corresponds with metabolic dysregulation and altered microglia morphology in mice deficient for Ifitm proteins. PMID:25856311
the importance of the C-terminal region of IFITM1 in modulating the antiviral function through controlling protein subcellular localization. PMID:25738301
Palmitoylation of IFITM1 regulates protein stability by preventing proteasomal degradation, and modification of the nonconserved cysteine at the IFITM1 C terminus supports an intramembrane topology with implications for anti-influenza A virus activity. PMID:23804635
the fact that IFITM1 can function as a negative regulator of cell proliferation, and because the gene maps to chromosome band 11p15.5, previously associated with NSCLC, it is likely that IFITM1 in man has a key role in tumor formation PMID:23115618
Fragilis2 regulates epithelialization of the somites and paraxial mesoderm formation. PMID:15857914
The antiproliferative action of IFN-gamma requires the induction of IFITM1. PMID:16847454