ALTSTEDPEPPSVPVPTNVLIKSYNLNPVVCWEYQNMSQTPIFTVQVKVYSGSWTDSCTN ISDHCCNIYEQIMYPDVSAWARVKAKVGQKESDYARSKEFLMCLKGKVGPPGLEIRRKKE EQLSVLVFHPEVVVNGESQGTMFGDGSTCYTFDYTVYVEHNRSGEILHTKHTVEKEECNE TLCELNISVSTLDSRYCISVDGISSFWQVRTEKSKDVCIPPFHDDRKDSIWILVVAPLTV FTVVILVFAYWYTKKNSFKRKSIMLPKSLLSVVKSATLETKPESKYSLVTPHQPAVLESE TVICEEPLSTVTAPDSPEAAEQEELSKETKALEAGGSTSAMTPDSPPTPTQRRSFSLLSS NQSGPCSLTAYHSRNGSDSGLVGSGSSISDLESLPNNNSETKMAEHDPPPVRKAPMASGY DKPHMLVDVLVDVGGKESLMGYRLTGEAQELS
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Receptor subunit for interferon gamma/INFG that plays crucial roles in antimicrobial, antiviral, and antitumor responses by activating effector immune cells and enhancing antigen presentation (, PubMed:20926559, PubMed:27286456). Associates with transmembrane accessory factor IFNGR2 to form a functional receptor. Upon ligand binding, the intracellular domain of IFNGR1 opens out to allow association of downstream signaling components JAK1 and JAK2. In turn, activated JAK1 phosphorylates IFNGR1 to form a docking site for STAT1. Subsequent phosphorylation of STAT1 leads to its dimerization, translocation to the nucleus, and stimulation of target gene transcription. STAT3 can also be activated in a similar manner although activation seems weaker. IFNGR1 intracellular domain phosphorylation also provides a docking site for SOCS1 that regulates the JAK-STAT pathway by competing with STAT1 binding to IFNGR1.
Gene References into Functions
significant upregulation of genes involved in inflammation and tissue remodeling in intestinal tumors of Ifngr1-/-ApcMin/+ mice when compared to those in Ifngr1+/+ApcMin/+ micePMID:27286456
These findings suggest that IFNGR1 signaling plays a pivotal role in placental pathology and subsequent adverse pregnancy outcomes during severe malaria. Our findings may increase our understanding of how disease aggravation occurs during malaria during pregnancy.PMID:29117241
Down regulation of macrophage IFNGR1 resists infection by Listeria monocytogenes.PMID:28542482
Marginal zone macrophage population loss is dependent on interferon gamma receptor but independent of T cells or tumor necrosis factor alpha receptor 1 signaling pathways.PMID:28808159
These results suggest that pulmonary C-fibers affect IFNGR1 expression by inducing IFN-alpha to regulate IFN-gamma-mediated airway inflammation and airway hyperresponsiveness.PMID:28772166
data define a novel B cell-intrinsic IFN-gammaR signaling pathway specific to Spt-GC development and autoimmunity.PMID:27069112
B cell type 1 IFN receptor signals accelerate, but are not required for, lupus development.PMID:27069113
These data offer direct evidence that tumor cell loss of the IFNGR1 gene, which results in loss of IFN-g signaling, leads to resistance to anti-CTLA-4 therapy.PMID:27667683
These data indicate that both GKO and GRKO mice fail to develop an IFN-gamma-mediated antiviral response, but differ in regulation of the inflammatory response to infection.PMID:24204622
IFN-gamma Ralpha is a key determinant of CD8+ T cell-mediated tumor elimination or tumor escape and relapse in FVB mouse.PMID:24324806
IFN-lambdaR limits T cell responses and memory after transient infection but augments T cell responses during persisting infection.PMID:24646741
Data indicate that prolonged IFNgammaR-/- dendritic cell survival promotes CD4 T cell expansion.PMID:24523506
IFNGR1 transcription is mediated by CTCF protein.PMID:22836578
Gamma interferon (IFN-gamma) receptor restricts systemic dengue virus replication and prevents paralysis in IFN-alpha/beta receptor-deficient mice.PMID:22973027
The present data indicate that IFN-gammaR plays an essential role in mediating the early immune mechanisms induced by the infection of erythrocytic stages of P. yoelii 17XL parasite, leading to host survival.PMID:22392138
these results demonstrate that IFN-gammaR may play a key role in CD4( ) T cell-mediated beta-cell destructionPMID:22865049
Cholesterol dependent modulation of IFNgamma mediated receptor subunit interaction in Leishmania donovani infected macrophages involve differential raft partitioning of IFNgammaR subunits.PMID:21931549
IFN-gamma is capable of promoting GVL effects via mechanisms independent of its interaction with leukemia cells.PMID:21835954
Mice lacking gamma interferon receptors are susceptible to junin virus infection.PMID:20926559
In contrast to peptide vaccination, IFN-gamma receptor signaling in CD8-positive T cells contributes to memory fate decision in response to lymphopenia, an effect that is fully reversed by high-affinity T cell receptor (TCR) ligands.PMID:20164422
IFNGR signaling in endothelial cells activates a potent peripheral negative feedback circuit that protects vascularized grafts from occlusive transplant vasculopathy.PMID:20049875
Inhibition of methylcholanthrene-induced carcinogenesis by an interferon gamma receptor-dependent foreign body reaction.PMID:12045246
Trophoblast cell invasion is accelerated in mice with a genetic deficiency in the Ifngr.PMID:12885563
Increased expresion in senescent spinal motoneuronsPMID:15505791
role of tyrosine 441 in attenuating SOCS-1 mediated STAT1 activationPMID:15522878
required for the protective pulmonary inflammatory response to Cryptococcus neoformansPMID:15731080
Development of IFN-gamma-producing B cells by either T-helper type 1 cells or IL-12/IL-18 is absolutely dependent on expression of the IFN-gamma receptor.PMID:15905519
severe impairment in the capacity of CD8 T cells lacking type I IFNR to expand in normal type I IFNR wild-type C57BL/6 hosts after LCMV infectionPMID:16585541
We show that demyelination in response to cuprizone is delayed in mice lacking the binding chain of IFNgamma receptor. In addition, IFNgammaR(-/-) mice exhibited an accelerated remyelination process after cuprizone was removed from the diet.PMID:16651614
demonstrates for first time that postnatal blocking of IFN-gamma function prevents atherosclerotic plaque formation in apoEKO mice by overexpressing IFN-gamma receptorPMID:17510508
IFNGR knockout mice were not protected from ischemia/reperfusion-induced liver damage.PMID:17935177
IFN-gamma concentration is both necessary and sufficient for graft rejection in IFN-gammaR1-deficient mice, inhibiting the development of heterologous, IFN-gammaR1-expressing, haematopoietic cell lineages.PMID:18232731
Graft-versus-host disease causes failure of donor hematopoiesis and lymphopoiesis in interferon-gamma receptor-deficient hosts.PMID:18552211
IFN-gammaR is a key element in the molecular machinery through which resting spinal microglia transform into an activated state that drives neuropathic painPMID:19380717
in the absence of host cell IFN-gammaR expression, both Th1 and Th2 cells lead to increased burden of C. trachomatisPMID:19561106
Show
More
Hide
All
Subcellular Location
Cell membrane; Single-pass type I membrane protein.