QECTKYKVSSCRDCIQSGPGCSWCQKLNFTGPGEPDSLRCDTRAQLLLKGCPADDIMDPRSIANPEFDQRGQRKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSMLDDLNNVKKLGGDLLQALNEITESGRIGFGSFVDKTVLPFVNTHPEKLRNPCPNKEKACQPPFAFRHVLKLTDNSNQFQTEVGKQLISGNLDAPEGGLDAIMQVAACPEEIGWRNVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDNMYKRSNEFDYPSVGQLAHKLSESNIQPIFAVTKKMVKTYEKLTEIIPKSAVGELSDDSSNVVQLIKNAYYKLSSRVFLDHSTLPDTLKVTYDSFCSNGASSIGKSRGDCDGVQINNPVTFQVKVMASECIQEQSFVIRALGFTDTVTVQVRPQCECQCRDQSREQSLCGGKGVMECGICRCESGYIGKNCECQTQGRSSQELERNCRKDNSSIVCSGLGDCICGQCVCHTSDVPNKEIFGQYCECDNVNCERYNSQVCGGSDRGSCNCGKCSCKPGYEGSACQCQRSTTGCLNARLVECSGRGHCQCNRCICDEGYQPPMCEDCPSCGSHCRDNHTSCAECLKFDKGPFEKNCSVQCAGMTLQTIPLKKKPCKERDSEGCWITYTLQQKDGRNIYNIHVEDSLECVKGPNVAAIVGGTVVGVVLIGVLLLVIWKALTHLTDLREYRRFEKEKLKSQWNNDNPLFKSATTTVMNPKFAES
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Integrin ITGAL/ITGB2 is a receptor for ICAM1, ICAM2, ICAM3 and ICAM4. Integrin ITGAL/ITGB2 is also a receptor for the secreted form of ubiquitin-like protein ISG15; the interaction is mediated by ITGAL. Integrins ITGAM/ITGB2 and ITGAX/ITGB2 are receptors for the iC3b fragment of the third complement component and for fibrinogen. Integrin ITGAX/ITGB2 recognizes the sequence G-P-R in fibrinogen alpha-chain. Integrin ITGAM/ITGB2 recognizes P1 and P2 peptides of fibrinogen gamma chain. Integrin ITGAM/ITGB2 is also a receptor for factor X. Integrin ITGAD/ITGB2 is a receptor for ICAM3 and VCAM1. Contributes to natural killer cell cytotoxicity. Involved in leukocyte adhesion and transmigration of leukocytes including T-cells and neutrophils. Triggers neutrophil transmigration during lung injury through PTK2B/PYK2-mediated activation. Integrin ITGAL/ITGB2 in association with ICAM3, contributes to apoptotic neutrophil phagocytosis by macrophages. In association with alpha subunit ITGAM/CD11b, required for CD177-PRTN3-mediated activation of TNF primed neutrophils. Integrin ITGAM/ITGB2 plays a critical role in mast cell development and in immune complex-mediated glomerulonephritis. Mice expressing a null mutation of the ITGAM subunit gene demonstrate increase in neutrophil accumulation, in response to a impaired degranulation and phagocytosis, events that apparently accelerate apoptosis in neutrophils. These mice develop obesity.
Gene References into Functions
CD18(-/-) leukocytes extravasated later than WT leukocytes. However, once extravasated, CD18(-/-) leukocytes transmigrated more rapidly than their WT counterparts. These results suggest that, although CD18 facilitates efficient extravasation, outside of the vessel CD18 interaction with the extracellular matrix, it reduced transmigration velocity.PMID:28904019
A modulatory role for the tumor beta2 subunit of the LFA-1 integrin in the metastatic progression of colorectal cancer to the liver by impaired activation of liver endothelium.PMID:29207960
Data show CD18 is selectively required for T helper 2, but not T helper 1, homing and has a minimal influence on T-effector development.PMID:14502280
in T cells, PI3Kdelta attenuates the activation of Rac1, but sustains the activation of Rap1.PMID:26740009
CD18 deficiency curbs methionine-choline-deficient-mediated liver injury by limiting the activation of innate immune cells in the liver without compromising intrahepatic cytokine activationPMID:28873429
results identify a role for Caveolin (Cav)1in membrane organization and beta2 integrin Lfa1 function in primary CD8 T cells.PMID:28637901
Coro1A represents an important novel player in integrin biology, with key functions in polymorphonuclear neutrophils trafficking during innate immunity.PMID:28615221
The data disclose a previously unknown function for alpha(1,3)-fucose, in which this structure negatively regulates the integrin activation step in leukocyte recruitment.PMID:27566832
These results identify CD47 as an important regulator of LFA-1 and VLA-4 integrin-adhesive functions in T cell proliferation.PMID:27965383
both GDF-15 and TGF-beta1 counteract chemokine-induced integrin activation on neutrophils via the ALK-5/TGF-betaRII heterodimer.PMID:27235139
the Slam locus has an overall inhibitory role during NK cell activation that is solely dependent on 2B4. This effect is influenced by cytokines and leads to suppression of LFA-1 activity.PMID:27573813
These results reveal a mechanism by which activated beta2 integrins limit neutrophil entry into the lung tissue and airspaces during acute pseudomonal pneumonia.PMID:28157452
Wild-type C57BL/6 mice with pristane-induced lupus developed a strong IFN signature, which was absent in immunoglobulin-deficient (muMT), C3(-/-) , and CD18(-/-) mice.PMID:27274010
Study suggest an important impact of NKT cells and postulate a critical function for LFA-1 during processes of liver regeneration.PMID:27977747
NDR1 kinase, activated by the Rap1 signaling cascade through RAPL and Mst1/Mst2, associated with and recruited kindlin-3 to the immunological synapses, which was required for high-affinity LFA-1/ICAM-1 binding.PMID:28137909
SLAT promotes TCR-mediated, Rap1-dependent LFA-1 activation and adhesion through interaction of its PH domain with Rap1.PMID:26483383
Gnb isoforms control a signaling pathway comprising Rac1, Plcbeta2, and Plcbeta3 leading to LFA-1 activation and neutrophil arrest in vivoPMID:26468229
Results show that beta2-integrins modulate glucose homeostasis during high fat feeding predominantly through actions on skeletal muscle to affect metabolic phenotype in vivo.PMID:26405763
report that beta2 and alpha4 integrins use different RIAM-dependent and -independent pathways to undergo activation by talinPMID:26337492
Timely blockade of ICAM-1.LFA-1 interaction prevents disease onset in a mouse model of emphysema.PMID:26098520
This study identified Mrp8/14 and TLR4 as important modulators of the leukocyte recruitment cascade during inflammation via integrin beta2.PMID:25892652
Integrin Beta2 expression on hematopoietic stem cells is regulated by hypercholesterolemia.PMID:25546260
Anti-OX40L mAb could prolong secondary heart allograft survival based on CD40/CD40L and LFA-1/ICAM-1 blockade.PMID:25613092
Alzheimer's disease model mice lacking LFA-1 were protected from cognitive declinePMID:26214837
Loss of the interaction between beta2-integrins and kindlin-3 abolishes the actin-linkage of integrins and the GM-CSF receptor in dendritic cells.PMID:25348463
Optimal T cell activation and B cell antibody responses in vivo require the interaction between Integrin beta2 and kindlin-3.PMID:25987740
The reduced expression of CD18 causes a cell-autonomous expansion in the hematopoietic stem cell compartment.PMID:24906078
Rab13 acts with Mst1 to regulate the spatial distribution of LFA-1 and the motility and trafficking of lymphocytesPMID:25074980
The combination of CCR2 and beta2 integrin engagement leads to an interaction between activated Rac2 and Myosin 9, resulting in augmented VEGF-A expression and induction of arteriogenesis.PMID:25180062
siglec-E promoted neutrophil production of reactive oxygen species following beta2-integrin ligation with fibrinogen in a sialic acid-dependent mannerPMID:24895121
Collectively, beta2 integrin-mediated systemic NET overflow is a novel viral mechanism of immunopathology that may be responsible for characteristic aspects of hantavirus-associated disease such as kidney and lung damage.PMID:24889201
Quantitative proteome analysis of alveolar type-II cells reveals a connection of integrin receptor subunits beta 2/6 and WNT signaling.PMID:24175614
Midkine seems to support neutrophil adhesion by promoting the high affinity conformation of beta2 integrins, thereby facilitating neutrophil trafficking during acute inflammation.PMID:24458438
beta2 integrin-mediated neutrophil crawling on endothelial ICAM-1 and ICAM-2 is a prerequisite for transcellular neutrophil diapedesis across the inflamed BBB.PMID:24259506
reduced expression promotes expansion of pathogenic gammadelta T cells in rine psoriasisPMID:24190659
LFA-1, but not alpha4 integrins, contributed to B-cell motility in peripheral lymph nodes.PMID:23558016
EC uptake of soluble MPO, namely the cell contact-dependent, beta2 integrin-mediated transfer from neutrophils. The findings could be of therapeutic relevance in atherosclerosis and vasculitis.PMID:23532856
Kindlin-1 and Kindlin-2 have opposite roles in lung cancersPMID:23209705
Behavioral deficits caused by prolonged IFN alpha treatment were not prevented by blocking LFA-1, which is involved in immune cell entry to the brain.PMID:23178534
CD18 expression levels impact regulatory T (Treg) cell development when Treg plasticity differentiation of Tregs into IL-17-producing T helper (Th)17 cells is facilitated by a subtotal deficiency of CD18.PMID:23418628
A novel function for LFA-1 in guiding T cells at the critical point of lymph nodes(LN) egress when they either exit or return into the LN for further interactions.PMID:23443048
beta(2) integrins limit TLR signaling by inhibiting NF-kappaB pathway activation and promoting p38 MAPK activation, thereby fine-tuning TLR-induced inflammatory responses.PMID:23310953
Nitric-oxide synthase-2 linkage to focal adhesion kinase in neutrophils influences enzyme activity and beta2 integrin functionPMID:23297409
The peripheral vascular niches composed of endothelial cells and smooth muscle cells may predispose haematopoietic CD34(+)CD31(+) progenitors to differentiate into endothelial cells through the activation of the ICAM-1/beta(2)-integrin cascade.PMID:22865639
Multivalent LFA-1/ICAM-1 bonds serve as mechanosensors that direct neutrophil cytoskeletal activity by transmission of tensile force to a supramolecular complex that triggers calcium influx at sites of adhesive contact.PMID:23144497
CXCL1-triggered interactions of ICAM1 and LFA1 are crucially involved in the trauma model of inflammation.PMID:23093821
SDF-1alpha releases LFA-1 from cytoskeleton, correlating with increased LFA-1-mediated adhesion under physiological shear stress.PMID:22875786
Experimental targeting of Ly6G has functional effects on the neutrophil population and identify a previously unappreciated role for Ly6G as a modulator of neutrophil migration to sites of inflammation via a beta2-integrin-dependent mechanism.PMID:22661700
Talin-1 is needed to induce LFA-1 extension, corresponding to intermediate affinity & causing neutrophil slow rolling. Talin-1 & kindlin-3 are needed to induce the high-affinity LFA-1 conformation with open headpiece, causing neutrophil arrest.PMID:22431571
analysis of activated apoptotic cells induce dendritic cell maturation via engagement of Toll-like receptor 4 (TLR4), dendritic cell-specific intercellular adhesion molecule 3 (ICAM-3)-grabbing nonintegrin (DC-SIGN), and beta2 integrinsPMID:22396536
Show
More
Hide
All
Subcellular Location
Cell membrane; Single-pass type I membrane protein. Membrane raft; Single-pass type I membrane protein.