Recombinant Mouse Integrin beta-2 (Itgb2)

Code: CSB-CF011884MO
Size:
20μg
20μg100μg
US$8092
Quantity:
Express system: in vitro E.coli expression system
Species: Mus musculus (Mouse)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
Itgb2
Uniprot NO.
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
24-771
Target Protein Sequence
QECTKYKVSSCRDCIQSGPGCSWCQKLNFTGPGEPDSLRCDTRAQLLLKGCPADDIMDPRSIANPEFDQRGQRKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSMLDDLNNVKKLGGDLLQALNEITESGRIGFGSFVDKTVLPFVNTHPEKLRNPCPNKEKACQPPFAFRHVLKLTDNSNQFQTEVGKQLISGNLDAPEGGLDAIMQVAACPEEIGWRNVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDNMYKRSNEFDYPSVGQLAHKLSESNIQPIFAVTKKMVKTYEKLTEIIPKSAVGELSDDSSNVVQLIKNAYYKLSSRVFLDHSTLPDTLKVTYDSFCSNGASSIGKSRGDCDGVQINNPVTFQVKVMASECIQEQSFVIRALGFTDTVTVQVRPQCECQCRDQSREQSLCGGKGVMECGICRCESGYIGKNCECQTQGRSSQELERNCRKDNSSIVCSGLGDCICGQCVCHTSDVPNKEIFGQYCECDNVNCERYNSQVCGGSDRGSCNCGKCSCKPGYEGSACQCQRSTTGCLNARLVECSGRGHCQCNRCICDEGYQPPMCEDCPSCGSHCRDNHTSCAECLKFDKGPFEKNCSVQCAGMTLQTIPLKKKPCKERDSEGCWITYTLQQKDGRNIYNIHVEDSLECVKGPNVAAIVGGTVVGVVLIGVLLLVIWKALTHLTDLREYRRFEKEKLKSQWNNDNPLFKSATTTVMNPKFAES
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Integrin ITGAL/ITGB2 is a receptor for ICAM1, ICAM2, ICAM3 and ICAM4. Integrin ITGAL/ITGB2 is also a receptor for the secreted form of ubiquitin-like protein ISG15; the interaction is mediated by ITGAL. Integrins ITGAM/ITGB2 and ITGAX/ITGB2 are receptors for the iC3b fragment of the third complement component and for fibrinogen. Integrin ITGAX/ITGB2 recognizes the sequence G-P-R in fibrinogen alpha-chain. Integrin ITGAM/ITGB2 recognizes P1 and P2 peptides of fibrinogen gamma chain. Integrin ITGAM/ITGB2 is also a receptor for factor X. Integrin ITGAD/ITGB2 is a receptor for ICAM3 and VCAM1. Contributes to natural killer cell cytotoxicity. Involved in leukocyte adhesion and transmigration of leukocytes including T-cells and neutrophils. Triggers neutrophil transmigration during lung injury through PTK2B/PYK2-mediated activation. Integrin ITGAL/ITGB2 in association with ICAM3, contributes to apoptotic neutrophil phagocytosis by macrophages. In association with alpha subunit ITGAM/CD11b, required for CD177-PRTN3-mediated activation of TNF primed neutrophils. Integrin ITGAM/ITGB2 plays a critical role in mast cell development and in immune complex-mediated glomerulonephritis. Mice expressing a null mutation of the ITGAM subunit gene demonstrate increase in neutrophil accumulation, in response to a impaired degranulation and phagocytosis, events that apparently accelerate apoptosis in neutrophils. These mice develop obesity.
Gene References into Functions
  1. CD18(-/-) leukocytes extravasated later than WT leukocytes. However, once extravasated, CD18(-/-) leukocytes transmigrated more rapidly than their WT counterparts. These results suggest that, although CD18 facilitates efficient extravasation, outside of the vessel CD18 interaction with the extracellular matrix, it reduced transmigration velocity. PMID:28904019
  2. A modulatory role for the tumor beta2 subunit of the LFA-1 integrin in the metastatic progression of colorectal cancer to the liver by impaired activation of liver endothelium. PMID:29207960
  3. Data show CD18 is selectively required for T helper 2, but not T helper 1, homing and has a minimal influence on T-effector development. PMID:14502280
  4. in T cells, PI3Kdelta attenuates the activation of Rac1, but sustains the activation of Rap1. PMID:26740009
  5. CD18 deficiency curbs methionine-choline-deficient-mediated liver injury by limiting the activation of innate immune cells in the liver without compromising intrahepatic cytokine activation PMID:28873429
  6. results identify a role for Caveolin (Cav)1in membrane organization and beta2 integrin Lfa1 function in primary CD8 T cells. PMID:28637901
  7. Coro1A represents an important novel player in integrin biology, with key functions in polymorphonuclear neutrophils trafficking during innate immunity. PMID:28615221
  8. The data disclose a previously unknown function for alpha(1,3)-fucose, in which this structure negatively regulates the integrin activation step in leukocyte recruitment. PMID:27566832
  9. These results identify CD47 as an important regulator of LFA-1 and VLA-4 integrin-adhesive functions in T cell proliferation. PMID:27965383
  10. both GDF-15 and TGF-beta1 counteract chemokine-induced integrin activation on neutrophils via the ALK-5/TGF-betaRII heterodimer. PMID:27235139
  11. the Slam locus has an overall inhibitory role during NK cell activation that is solely dependent on 2B4. This effect is influenced by cytokines and leads to suppression of LFA-1 activity. PMID:27573813
  12. These results reveal a mechanism by which activated beta2 integrins limit neutrophil entry into the lung tissue and airspaces during acute pseudomonal pneumonia. PMID:28157452
  13. Wild-type C57BL/6 mice with pristane-induced lupus developed a strong IFN signature, which was absent in immunoglobulin-deficient (muMT), C3(-/-) , and CD18(-/-) mice. PMID:27274010
  14. Study suggest an important impact of NKT cells and postulate a critical function for LFA-1 during processes of liver regeneration. PMID:27977747
  15. NDR1 kinase, activated by the Rap1 signaling cascade through RAPL and Mst1/Mst2, associated with and recruited kindlin-3 to the immunological synapses, which was required for high-affinity LFA-1/ICAM-1 binding. PMID:28137909
  16. SLAT promotes TCR-mediated, Rap1-dependent LFA-1 activation and adhesion through interaction of its PH domain with Rap1. PMID:26483383
  17. Gnb isoforms control a signaling pathway comprising Rac1, Plcbeta2, and Plcbeta3 leading to LFA-1 activation and neutrophil arrest in vivo PMID:26468229
  18. Results show that beta2-integrins modulate glucose homeostasis during high fat feeding predominantly through actions on skeletal muscle to affect metabolic phenotype in vivo. PMID:26405763
  19. report that beta2 and alpha4 integrins use different RIAM-dependent and -independent pathways to undergo activation by talin PMID:26337492
  20. Timely blockade of ICAM-1.LFA-1 interaction prevents disease onset in a mouse model of emphysema. PMID:26098520
  21. This study identified Mrp8/14 and TLR4 as important modulators of the leukocyte recruitment cascade during inflammation via integrin beta2. PMID:25892652
  22. Integrin Beta2 expression on hematopoietic stem cells is regulated by hypercholesterolemia. PMID:25546260
  23. Anti-OX40L mAb could prolong secondary heart allograft survival based on CD40/CD40L and LFA-1/ICAM-1 blockade. PMID:25613092
  24. Alzheimer's disease model mice lacking LFA-1 were protected from cognitive decline PMID:26214837
  25. Loss of the interaction between beta2-integrins and kindlin-3 abolishes the actin-linkage of integrins and the GM-CSF receptor in dendritic cells. PMID:25348463
  26. Optimal T cell activation and B cell antibody responses in vivo require the interaction between Integrin beta2 and kindlin-3. PMID:25987740
  27. The reduced expression of CD18 causes a cell-autonomous expansion in the hematopoietic stem cell compartment. PMID:24906078
  28. Rab13 acts with Mst1 to regulate the spatial distribution of LFA-1 and the motility and trafficking of lymphocytes PMID:25074980
  29. The combination of CCR2 and beta2 integrin engagement leads to an interaction between activated Rac2 and Myosin 9, resulting in augmented VEGF-A expression and induction of arteriogenesis. PMID:25180062
  30. siglec-E promoted neutrophil production of reactive oxygen species following beta2-integrin ligation with fibrinogen in a sialic acid-dependent manner PMID:24895121
  31. Collectively, beta2 integrin-mediated systemic NET overflow is a novel viral mechanism of immunopathology that may be responsible for characteristic aspects of hantavirus-associated disease such as kidney and lung damage. PMID:24889201
  32. Quantitative proteome analysis of alveolar type-II cells reveals a connection of integrin receptor subunits beta 2/6 and WNT signaling. PMID:24175614
  33. Midkine seems to support neutrophil adhesion by promoting the high affinity conformation of beta2 integrins, thereby facilitating neutrophil trafficking during acute inflammation. PMID:24458438
  34. beta2 integrin-mediated neutrophil crawling on endothelial ICAM-1 and ICAM-2 is a prerequisite for transcellular neutrophil diapedesis across the inflamed BBB. PMID:24259506
  35. reduced expression promotes expansion of pathogenic gammadelta T cells in rine psoriasis PMID:24190659
  36. LFA-1, but not alpha4 integrins, contributed to B-cell motility in peripheral lymph nodes. PMID:23558016
  37. EC uptake of soluble MPO, namely the cell contact-dependent, beta2 integrin-mediated transfer from neutrophils. The findings could be of therapeutic relevance in atherosclerosis and vasculitis. PMID:23532856
  38. Kindlin-1 and Kindlin-2 have opposite roles in lung cancers PMID:23209705
  39. Behavioral deficits caused by prolonged IFN alpha treatment were not prevented by blocking LFA-1, which is involved in immune cell entry to the brain. PMID:23178534
  40. CD18 expression levels impact regulatory T (Treg) cell development when Treg plasticity differentiation of Tregs into IL-17-producing T helper (Th)17 cells is facilitated by a subtotal deficiency of CD18. PMID:23418628
  41. A novel function for LFA-1 in guiding T cells at the critical point of lymph nodes(LN) egress when they either exit or return into the LN for further interactions. PMID:23443048
  42. beta(2) integrins limit TLR signaling by inhibiting NF-kappaB pathway activation and promoting p38 MAPK activation, thereby fine-tuning TLR-induced inflammatory responses. PMID:23310953
  43. Nitric-oxide synthase-2 linkage to focal adhesion kinase in neutrophils influences enzyme activity and beta2 integrin function PMID:23297409
  44. The peripheral vascular niches composed of endothelial cells and smooth muscle cells may predispose haematopoietic CD34(+)CD31(+) progenitors to differentiate into endothelial cells through the activation of the ICAM-1/beta(2)-integrin cascade. PMID:22865639
  45. Multivalent LFA-1/ICAM-1 bonds serve as mechanosensors that direct neutrophil cytoskeletal activity by transmission of tensile force to a supramolecular complex that triggers calcium influx at sites of adhesive contact. PMID:23144497
  46. CXCL1-triggered interactions of ICAM1 and LFA1 are crucially involved in the trauma model of inflammation. PMID:23093821
  47. SDF-1alpha releases LFA-1 from cytoskeleton, correlating with increased LFA-1-mediated adhesion under physiological shear stress. PMID:22875786
  48. Experimental targeting of Ly6G has functional effects on the neutrophil population and identify a previously unappreciated role for Ly6G as a modulator of neutrophil migration to sites of inflammation via a beta2-integrin-dependent mechanism. PMID:22661700
  49. Talin-1 is needed to induce LFA-1 extension, corresponding to intermediate affinity & causing neutrophil slow rolling. Talin-1 & kindlin-3 are needed to induce the high-affinity LFA-1 conformation with open headpiece, causing neutrophil arrest. PMID:22431571
  50. analysis of activated apoptotic cells induce dendritic cell maturation via engagement of Toll-like receptor 4 (TLR4), dendritic cell-specific intercellular adhesion molecule 3 (ICAM-3)-grabbing nonintegrin (DC-SIGN), and beta2 integrins PMID:22396536

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein. Membrane raft; Single-pass type I membrane protein.
Protein Families
Integrin beta chain family
Database Links

UNIGENE: Mm.1137

KEGG: mmu:16414

STRING: 10090.ENSMUSP00000000299

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products