Recombinant Mouse Induced myeloid leukemia cell differentiation protein Mcl-1 homolog (Mcl1)

Code: CSB-CF013588MO
Size:
20μg
20μg100μg
US$4971
Quantity:
Express system: in vitro E.coli expression system
Species: Mus musculus (Mouse)
Tag Info: 10xHis-SUMO-tag
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
Mcl1
Uniprot NO.
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
1-331
Target Protein Sequence
MFGLRRNAVIGLNLYCGGASLGAGGGSPAGARLVAEEAKARREGGGEAALLPGARVVARP PPVGAEDPDVTASAERRLHKSPGLLAVPPEEMAASAAAAIVSPEEELDGCEPEAIGKRPA VLPLLERVSEAAKSSGADGSLPSTPPPPEEEEDDLYRQSLEIISRYLREQATGSKDSKPL GEAGAAGRRALETLRRVGDGVQRNHETAFQGMLRKLDIKNEGDVKSFSRVMVHVFKDGVT NWGRIVTLISFGAFVAKHLKSVNQESFIEPLAETITDVLVRTKRDWLVKQRGWDGFVEFF HVQDLEGGIRNVLLAFAGVAGVGAGLAYLIR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
10xHis-SUMO-tag
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Involved in the regulation of apoptosis versus cell survival, and in the maintenance of viability but not of proliferation. Mediates its effects by interactions with a number of other regulators of apoptosis. Isoform 2 has antiapoptotic activity.
Gene References into Functions
  1. These results indicate that the outer membrane protein MCL1 is degraded by the VCP-UBXD1 complex and that the process is promoted by the presence of mutant Huntingtin. PMID:27913212
  2. miR-29b suppressed cellular proliferation and promoted apoptosis of pulmonary artery smooth muscle cells, possibly through the inhibition of Mcl-1 and CCND2. PMID:29662889
  3. Authors treated Mcl-1(+/-) heterozygous mice, which have a ~50% reduction in MCL-1 protein in their cells, with a broad range of chemotherapeutic drugs. Monitoring of treated mice revealed that a wide range of chemotherapeutic drugs had no significant effect on the general well-being of Mcl-1(+/-) mice with no overt damage to a broad range of tissues. PMID:28800129
  4. analysis of how a hydrophobic staple induces an unanticipated structural rearrangement in Mcl-1 upon binding PMID:29339518
  5. Mcl-1 is a disease-specific target of Cdk5, which associates with Cdk5 under basal conditions, but is not regulated by it. PMID:28751497
  6. These findings elucidate a crucial molecular pathway of B cell selection in the earliest phases of activation by identifying a novel link between B cell receptor affinity and BAFF-R signaling towards Mcl-1. PMID:27762293
  7. Even though the Mcl-1 protein in Mcl1-flox-del homozygous animals is normal, the males were still infertile. PMID:27906183
  8. The findings support a model in which survival is determined by quantitative participation of multiple anti-apoptotic proteins, BCL2, Mcl1, and BCL2A1, rather than by a single anti-apoptotic protein. PMID:28362427
  9. This dynamic change in B cell survival mechanisms is unique to Epstein-Barr virus-infected cells and relies on regulation of MCL-1 mitochondrial localization and BFL-1 transcription by the viral EBNA3A protein. PMID:28425914
  10. Overexpression of Mcl-1 via the hemopoietic cell specific vavP-Mcl-1 transgene markedly exacerbates and accelerates the lpr phenotype. The progressive splenomegaly and lymphadenopathy displayed by lpr mice was far more severe in Mcl-1tg/lpr littermates PMID:27813531
  11. Endothelial cell -specific deletion of Mcl1 resulted in a dose-dependent increase in endothelial cell apoptosis in the angiogenic vasculature and a corresponding decline in vessel density. PMID:26943318
  12. Our findings indicate that MCL-1 expression is an important biomarker of TEC survival PMID:28972012
  13. These results identify MCL-1 as a critical prosurvival protein for preventing beta-cell death and clarify the mechanisms behind its downregulation by proinflammatory cytokines. PMID:28667119
  14. These data show that Mcl-1 is dispensable for the regulation of apoptosis during infection with different large DNA viruses.Bcl-XL, on the other hand, can be important to maintain survival of virus-infected cells PMID:27537523
  15. BCL-XL expression promotes survival of immature B cells, expression of BCL-2 is important for survival of mature B cells and long-lived plasma cells (PC), and expression of MCL-1 is important for survival throughout B-cell development. PMID:27560714
  16. miR-32/MCL-1 pathway members were identified as key early genetic events driving melanoma progression. PMID:27846237
  17. GSK3B-MCL1 signaling to regulate axonal autophagy might be important for the successful completion of Wallerian degeneration. PMID:28053206
  18. Specific downregulation of Mcl-1 significantly increases apoptosis of peritoneal macrophages and that the MAPK signaling pathway is the primary mediator of Mcl-1 expression. PMID:26876933
  19. MCL1 plays a pivotal role in Leydig-cell steroidogenesis, and might provide novel insights into metabolic regulation in this cell PMID:26995740
  20. Although loss of one Mcl-1 allele did not noticeably impair the survival of normal B lymphoid cells, it markedly diminished the survival of Proto-Oncogene Proteins c-myc overexpressing B cell progenitors. PMID:26947081
  21. MCL-1 loss in early B-lymphoid progenitors delayed MYC-driven lymphomagenesis. PMID:26962682
  22. High Mcl-1 levels enhanced mTOR phosphorylation and augmented the differentiation of terminal effector cells and effector memory CD8 T cells. PMID:26855329
  23. Data suggest Leishmania donovani exploits host anti-apoptotic protein MCL-1 to prevent apoptosis of host macrophages upon treatment with antiparasitic agents; thus, L. donovani protects its host, a factor in progression of visceral leishmaniasis. PMID:26670606
  24. Data demonstrate that soluble factors from MM cells are able to generate MDSC through Mcl-1 upregulation. PMID:25871384
  25. a mechanism of inverse coregulation between BECN1 and MCL1 significantly contributes to their opposing roles in tumorigenesis PMID:25837021
  26. There is a non-redundant pathway linking IL-15 to Mcl1 in the maintenance of NK cells and innate immune responses in vivo. PMID:25119382
  27. Authors recognize MCL-1 as the essential survival factor required for conservation of the postnatal PMF pool, growing follicle survival and effective oocyte mitochondrial function. PMID:25950485
  28. Tax interacted with and activated TRAF6, and triggered its mitochondrial localization, where it conjugated four carboxyl-terminal lysine residues of MCL-1 with lysine 63-linked polyubiquitin chains PMID:25340740
  29. deletion of Mir155 prevents Fas-induced hepatocyte apoptosis and liver injury through the up-regulation of Mcl1. PMID:25794705
  30. Inverse co-regulation of Beclin 1 and Mcl-1 represents a mechanism of functional counteraction in cancer. PMID:25472497
  31. miR-29a is involved in the pathogenesis of ulcerative colitis by regulating intestinal epithelial apoptosis via Mcl-1. PMID:25674218
  32. MCL1, but not that of BAK, forms stable heterodimeric complexes with cBID in a manner adjustable by membrane cardiolipin content and curvature degree. PMID:25987560
  33. MCL1 has lipid-dependent bimodal membrane activity. PMID:25314294
  34. These results demonstrate that antagonism between PUMA and MCL-1 constitutes the major axis of control of hematopoietic stem cell survival. PMID:25847014
  35. Cafestol overcomes ABT-737 resistance in Mcl-1-overexpressed renal carcinoma Caki cells through downregulation of Mcl-1 expression and upregulation of Bim expression. PMID:25375379
  36. These data demonstrate that Mcl-1 is essential for mammopoiesis and identify EGF as a critical trigger of Mcl-1 translation to ensure survival of milk-producing alveolar cells. PMID:25730472
  37. conditional gene deletion and loss of the granulocytic subset does not alter tumor growth or incidence in vivo PMID:25500368
  38. analysis of the role of BCL-XL or MCL-1 in the development and sustained growth of thymic lymphoma elicited by loss of p53 reveals that only MCL-1 is critical PMID:25368374
  39. Downregulation of Mcl-1 has anti-inflammatory pro-resolution effects and enhances bacterial clearance from the lung. PMID:24280938
  40. Pro-apoptotic Bim and anti-apoptotic Mcl-1. PMID:24825007
  41. Mcl-1 positively regulates cell viability and negatively regulates the bone-resorbing activity of osteoclasts both in vitro and in vivo. PMID:24096094
  42. Noxa is targeted to the mitochondrial membrane where it neutralises Mcl-1 via its C-terminal BH3-domain. PMID:23733106
  43. Data indicate that Mcl-1 deficient embryonic fibroblasts (MEFs) reliant only on Bcl-XL for survival, and Bax/Bak deficient MEFs support a mechanism-based induction of apoptosis. PMID:23767404
  44. mouse Mcl1 is a prosurvival Bcl2 relative that blunts stress-induced apoptosis, causes male sterility, and promotes tumorigenesis PMID:24363325
  45. Notch1 inhibits apoptosis of stimulated macrophages by directly controlling the mcl1 promoter. PMID:23872918
  46. Mcl-1 is critical for promoting effector T-cell responses, but does so by combating pro-apoptotic molecules beyond Bim. PMID:23558951
  47. Loss of parkin function through biallelic mutation of PARK2 may lead to death of dopaminergic neurons through unregulated SCF(Fbw7beta)-mediated ubiquitylation-dependent proteolysis of Mcl-1. PMID:23858059
  48. data support the metabolic control of Mcl-1 expression as a key event in the effects of caloric restriction in sensitizing lymphoma cells to apoptosis PMID:23966420
  49. Antiapoptotic Mcl-1 is critical for the survival and niche-filling capacity of Foxp3 regulatory T cells. PMID:23852275
  50. In the absence of p27(Kip1), Mcl1 failed to induce neural progenitor cell (NPC) cell cycle exit, demonstrating that p27(Kip1) is required for Mcl1-mediated NPC terminal mitosis. PMID:23824576

Show More

Hide All

Subcellular Location
Membrane; Single-pass membrane protein. Cytoplasm. Mitochondrion. Nucleus, nucleoplasm. Note=Cytoplasmic, associated with mitochondria.
Protein Families
Bcl-2 family
Database Links

UNIGENE: Mm.1639

KEGG: mmu:17210

STRING: 10090.ENSMUSP00000044048

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products