Fcer1g; Fce1g; High affinity immunoglobulin epsilon receptor subunit gamma; Fc receptor gamma-chain; FcRgamma; Fc-epsilon RI-gamma; IgE Fc receptor subunit gamma; FceRI gamma
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
19-86
Target Protein Sequence
LGEPQLCYILDAVLFLYGIVLTLLYCRLKIQVRKAAIASREKADAVYTGLNTRSQETYETLKHEKPPQ
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Adapter protein containing an immunoreceptor tyrosine-based activation motif (ITAM) that transduces activation signals from various immunoreceptors. As a component of the high-affinity immunoglobulin E (IgE) receptor, mediates allergic inflammatory signaling in mast cells. As a constitutive component of interleukin-3 receptor complex, selectively mediates interleukin 4/IL4 production by basophils, priming T-cells toward effector T-helper 2 subset. Associates with pattern recognition receptors CLEC4D and CLEC4E to form a functional signaling complex in myeloid cells. Binding of mycobacterial trehalose 6,6'-dimycolate (TDM) to this receptor complex leads to phosphorylation of ITAM, triggering activation of SYK, CARD9 and NF-kappa-B, consequently driving maturation of antigen-presenting cells and shaping antigen-specific priming of T-cells toward effector T-helper 1 and T-helper 17 cell subtypes (Probable). May function cooperatively with other activating receptors. Functionally linked to integrin beta-2/ITGB2-mediated neutrophil activation. Also involved in integrin alpha-2/ITGA2-mediated platelet activation.
Gene References into Functions
CD23 deficiency impacts the early cellular event of B-cell receptor (BCR) activation.PMID:27181049
Dock10 negatively regulates membrane CD23 expression; negative regulation of CD23 expression by Dock10 could play a role in B cell maturation and functionPMID:27502165
data are significant in uncovering a latent, but potent, negative-regulatory role for Myd88 and Fcer1g in the late stages of B cell responses; such roles could limit acute responses; however, they could be particularly significant in chronic responses, such as autoimmunity and chronic infectionPMID:28659358
FcgammaR-mediated Syk activation leads to NLRP3 inflammasome-dependent IL-1beta production in macrophages and suggests that an Nlrp3- and IL-1R-dependent process contributes to the IgA response important for protection against Francisella tularensis LVS.PMID:27365531
this study reveal an autonomous membrane IgE signaling mechanism that normally prevents IgE(+) memory B cells and long-lived plasma cells formation, providing insights into the molecular pathogenesis of allergic diseases.PMID:27428827
Galectin-3 regulates IgE receptor signaling in mast cells.PMID:26929198
these results identify a previously unproven mechanism in which epithelial CD23 plays a central role in the development of allergic inflammationPMID:25783969
In mast cells, ORMDL3 functions predominantly as a negative regulator of FcepsilonRI-mediated signaling events leading to the expression of proinflammatory mediators and chemotaxis.PMID:26407610
Data show that although phospholipase D PLD1 deficiency impaired Fc epsilon receptor FcepsilonRI-mediated signaling and mast cell function, phospholipase D PLD2 deficiency actually enhanced these pathways.PMID:26392467
Glomerulonephritis in FcRgamma-/- chimeras was no different from wild type.PMID:25565310
Acidic pH augments Fc-epsilon-RI-mediated production of IL-6 and IL-13 in mast cells.PMID:26196745
Canonical tyrosine residues mutation in FceRIg ITAM (Y65 and Y76) reveals that these two tyrosine residues in gamma subunit are required for its interaction with type II PtdIns 4-kinases.PMID:24481753
Data indicate that phosphorylation of Tyr114 and Tyr259 of prohibitin (PHB) is critical for the association of PHB with FcRI and Syk.PMID:24023254
critical for TGFbeta2-treated macrophage-induced tolerancePMID:23643295
plays role in beta2 adrenergic receptor-induced increase in IgE on B cellsPMID:24140643
the CD23 surface level and serum IgE level are uncoupled and that neither is directly regulated by the mutations within the CD23 coding region.PMID:23646151
these data reveal a novel role for FcRgamma in promoting peripheral T cell apoptosis in Fas-deficient mice, which may be of significant value in understanding autoimmune lymphoproliferative syndromes.PMID:23313147
Fcgamma receptor deficiency attenuates diabetic nephropathy in mice.PMID:22859852
Low affinity IgE competes with high affinity IgE for binding to Fcepsilon receptors and prevents anaphylaxis and is thus beneficial.PMID:22249450
Rab35 regulates phagosome formation through recruitment of ACAP2 in macrophages during FcgammaR-mediated phagocytosis.PMID:22045739
regulates T helper cell differentiation through FcgammaRIII mediated dendritic cell cytokine modulationPMID:20494341
Experiments with knockout mice show that the high-affinity FC receptors for IGG and IGE are necessary for Brugia microfilaria clearance.PMID:11920579
data indicate that ligation of Fcgamma receptors activates Lyn followed by Syk kinase during phagocytosisPMID:12056610
that CD23 on murine Langerhans cells may be involved in IgE-mediated immune responses.PMID:12164935
Fc epsilon RI gamma-mediated signals differentially regulate the receptor expression, activation, and survival of mast cells and systemic anaphylaxis.PMID:14764707
FcRgamma-mediated signal transduction is involved in osteoclast differentiation.PMID:15184345
LAB shares a redundant function with LAT to play a positive role in FcepsilonRI-mediated signaling.PMID:15477350
These results demonstrate that expression of FcRgamma, most likely FcgammaRI, on APCs is important during the sensitization phase for the development of allergic airway inflammation and airway hyperresponsiveness.PMID:17182587
These results suggest that the restoration of FcRgamma/Fyn signaling represents a new approach for the treatment of demyelinating diseases.PMID:17290413
Fc receptors gamma chain may play the pivotal role in endothelial dysfunction through oxidative stress induced by hypercholesterolaemia.PMID:18694873
Data show that a pathway involving Fgr, DAP12 and FcRgamma is involved in the initial signaling events downstream of E-selectin-engaged PSGL-1 that are required to initiate neutrophil slow rolling.PMID:18794338
Data suggest that flagellin-specific IgG/Fc gamma receptor I complex immune responses activate mast cells in the intestine and play important roles in the pathogenesis of intestinal immune inflammation.PMID:18974296
Suppression of experimental immune thrombocytopenic purpura by human C-reactive protein (CRP)-treated splenocytes requires Fc gamma receptor type I on the donor macrophage and Fc gamma receptor type IIb in the recipient mice.PMID:19155486
Show
More
Hide
All
Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Protein Families
CD3Z/FCER1G family
Tissue Specificity
Expressed in mast cells (at protein level). Expressed in basophils (at protein level).