Recombinant Mouse Growth hormone receptor (Ghr)

Code: CSB-CF009411MO
Size:
20μg
20μg100μg
US$7179
Quantity:
Express system: in vitro E.coli expression system
Species: Mus musculus (Mouse)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
Ghr
Uniprot NO.
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
25-650
Target Protein Sequence
TPATLGKASPVLQRINPSLGTSSSGKPRFTKCRSPELETFSCYWTEGDNPDLKTPGSIQLYYAKRESQRQAARIAHEWTQEWKECPDYVSAGKNSCYFNSSYTSIWIPYCIKLTTNGDLLDQKCFTVDEIVQPDPPIGLNWTLLNISLTGIRGDIQVSWQPPPNADVLKGWIILEYEIQYKEVNESKWKVMGPIWLTYCPVYSLRMDKEHEVRVRSRQRSFEKYSEFSEVLRVIFPQTNILEACEEDIQFPWFLIIIFGIFGVAVMLFVVIFSKQQRIKMLILPPVPVPKIKGIDPDLLKEGKLEEVNTILGIHDNYKPDFYNDDSWVEFIELDIDEADVDEKTEGSDTDRLLSNDHEKSAGILGAKDDDSGRTSCYDPDILDTDFHTSDMCDGTLKFRQSQKLNMEADLLCLDQKNLKNLPYDASLGSLHPSITQTVEENKPQPLLSSETEATHQLASTPMSNPTSLANIDFYAQVSDITPAGGDVLSPGQKIKAGIAQGNTQREVATPCQENYSMNSAYFCESDAKKCIAVARRMEATSCIKPSFNQEDIYITTESLTTTAQMSETADIAPDAEMSVPDYTTVHTVQSPRGLILNATALPLPDKKNFPSSCGYVSTDQLNKIMQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Receptor for pituitary gland growth hormone involved in regulating postnatal body growth. On ligand binding, couples to, and activates the JAK2/STAT5 pathway.; The soluble form (GHBP) acts as a reservoir of growth hormone in plasma and may be a modulator/inhibitor of GH signaling.
Gene References into Functions
  1. GHR -/- mice had decreased body weight but increased percent fat mass. Serum FGF21 levels were unchanged in GHR -/- mice. Expression of Fgf21, Fgfr1, and Klb mRNA in white AT and liver were downregulated or unchanged inGHR -/- mice. The only exception was Fgf21 expression in brown AT of GHR -/-, which trended toward increased expression. PMID:27585733
  2. A role for GH in influencing hormone signaling in adipose tissue in a depot-dependent manner in GHR-/- knock-out mice. PMID:28323915
  3. disruption of cardiomyocyte GH-induced signaling in adult GhrKO mice does not affect cardiac function, but it does play a role in systemic glucose homeostasis, in part through modulation of circulating IGF-1. PMID:27035649
  4. Snell, GHKRO, and PAPPA-KO mice express high levels of two proteins involved in DNA repair, O-6-methylguanine-DNA methyltransferase (MGMT) and N-myc downstream-regulated gene 1 (NDRG1). PMID:27618784
  5. adult-onset growth hormone receptor knockout mice (aGHRKO mice), like GHRKO animals, displayed retarded growth and high adiposity with improved insulin sensitivity. Importantly, female aGHRKO animals showed an increase in their maximal lifespan, whereas the lifespan of male aGHRKO mice was not different from controls. PMID:27732088
  6. Similar to other mice with decreased GH action, female GHA mice display reduced age-related lipid redistribution and improved insulin sensitivity, but no change in cellular senescence. PMID:26372907
  7. The dwarf phenotype was partially corrected via plasmid containing the growth hormone gene administrated intramuscularly, depending on age at treatment. PMID:26774398
  8. GHR-dependent downregulation of NLRP3 inflammasome in macrophages is linked to pro-longevity effects that maintain immune system homeostasis in aging. PMID:26876170
  9. both brown adipose tissue (BAT) and white adipose tissue (WAT) contribute in different ways to phenotypes in GHRKO mice, with Ghr ablation blunting inflammation in BAT as well as cellular metabolism and mitochondrial biogenesis in WAT PMID:26436954
  10. Data (including data from studies in knockout mice) suggest Socs2 (suppressor of cytokine signaling 2) regulates liver regeneration rate after partial hepatectomy, Ghr level via ubiquitination/proteolysis, and serum Igf1 (insulin-like growth factor-1). PMID:26703468
  11. removal of GHR in muscle of male MuGHRKO mice replicates some of the health benefits seen in global GHR-/- mice including improvements to glucose homeostasis and smaller body weight in males PMID:26233957
  12. GHR knockdown caused increased hepatic de novo lipogenesis (DNL) as well as increased glucokinase mRNA and protein levels as well as fructose-2,6-bisphosphate levels. PMID:26015548
  13. deletion in liver affects regulators of mitochondrial biogenesis PMID:25855408
  14. Global GHR deletion induces beneficial changes in apoptotic factors, whereas liver-specific GHR disruption does not. Sexual dimorphism may play a role in regulating apoptosis during liver-specific suppression of the somatotrophic signaling. PMID:24550353
  15. loss of Ghr signaling may slow the progression from fibrosis/cirrhosis to cancer in the liver PMID:25179284
  16. Mice in which GHR has been disrupted only in the liver do not show extended lifespan and also fail to show the decline in mTORC1 and increase in mTORC2 seen in mice with global loss of GHR. PMID:25456069
  17. Hematopoietic-specific genetic deletion of Ghr neither impacted steady-state hematopoiesis nor serial transplantation potential. PMID:25274507
  18. GHRs occur as approximately 500-kDa complexes that dimerize into active approximately 900-kDa complexes upon GH binding. The dimerized complexes act as platforms for transient interaction with JAK2 and ubiquitin ligases. PMID:24280222
  19. Data from mutant/knockout mice suggest that Ghr in liver (not muscle or adipose tissue) is involved in regulation of expression of xenobiotic metabolizing enzymes. PMID:23941873
  20. Data from knockout/transgenic mice suggest that neither Ghr nor Igf1r (insulin-like growth factor I receptor) signaling is required for postnatal skeletal muscle development or for regeneration in response to cardiotoxin injury. PMID:23861377
  21. Serum IGF-1 is insufficient to restore skeletal size in the total absence of the growth hormone receptor. PMID:23456957
  22. Results suggest that GH sensitivity is rapidly impaired after acute injury and that trauma combined with hemorrhage results in a more severe form of GH resistance resulting from alteration or inactivation of hepatic GHR. PMID:23417424
  23. Upregulation of the angiotensin-converting enzyme 2/angiotensin-(1-7)/Mas receptor axis in the heart and the kidney of growth hormone receptor knock-out mice PMID:22947377
  24. muscle growth hormone receptor signaling regulates basal lipid oxidation, but not the induction of lipid oxidation in response to fasting. PMID:23024761
  25. These results suggest that diabetes induces an imbalance in the GH/IGF-1 system leading to altered activity in the PFC and associated cognitive deficiencies. PMID:22750159
  26. insulin-like growth factor I receptor may serve as a proximal component of growth hormone/growth hormone receptor signaling, contributing to enhancement of pancreatic beta-cell mass and function PMID:22034225
  27. Skeletal muscle GHR signaling mediates insulin resistance in obesity and, more importantly, has a role in facilitating cross-talk between muscle and other metabolic tissues. PMID:22187377
  28. The renal levels of PGC-1alpha, AMPKalpha, p-AMPKalpha, SIRT-3, eNOS, p-eNOS and MFN-2 were increased in growth hormone receptor knockout. PMID:21755522
  29. Data suggest that GHR signaling plays a major role in liver regeneration and that GHR acts through activation of both epidermal growth factor receptor and Erk1/2 pathways. Liver regeneration is severely delayed in mutant GHR knockout mice. PMID:21540290
  30. Data indicate a role for GH in establishing pubertal skeletal and body size that is independent of hepatic IGF-1 production. PMID:20928887
  31. GH receptor plays critical roles in glucose-stimulated insulin secretion and beta cell compensation in response to a high-fat diet. PMID:21555853
  32. The decreased renal levels of pro-apoptotic proteins could contribute to the extended life-span caused by targeted disruption of the GH receptor gene but are apparently not involved in mediating the effects of visceral fat removal. PMID:21391871
  33. These results identify distinct signaling pathways through which the growth hormone receptor regulates skeletal muscle development and modulates nutrient metabolism. PMID:20921627
  34. Compared to wild type controls, the GHR -/- mice were smaller, consumed more food, and had greater energy expenditure. PMID:19747867
  35. In studies using targeted knock-in mice with mutation in the Ghr Box1 motif (disabling Jak2 activation by Ghr), data indicate Ghr activation of Src and Erk1/2 is independent of Jak2. PMID:19884384
  36. intermittent fasting diet increased the survivorship and improved insulin sensitivity of normal males, but failed to affect either parameter in GHR-KO mice. PMID:19747233
  37. although growth hormone receptor knockout female mice are fertile, they exhibit quantitative deficits in various parameters of reproductive function PMID:12297526
  38. in the kidney diabetes mellitus is associated with enhanced GHR expression and lack of alteration in the assembly of the repressosome complex PMID:12529387
  39. the degree of blockade of growth hormone receptor signaling can lead to dramatically different phenotypes. PMID:12933651
  40. Data suggest that expression of truncated growth hormone receptors (GHRs) is regulated in a different manner from that of the full-length GHR, thereby modulating growth hormone action in murine adipocytes. PMID:14615057
  41. Aryl hydrocarbon receptor mediates suppression of Ghr. PMID:14759523
  42. Located on caveolae and lipid rafts of 3t3 cells. PMID:15010456
  43. serum igf-i levels and body weights of mature Ghsr-null mice are modestly reduced compared to wild-type littermates. PMID:15070777
  44. Average size of islets found in GHR(-/-) mice was only one-third of that in wild-type littermates. Total beta-cell mass was reduced 4.5-fold in GHR(-/-) mice, significantly more than their body size reduction. PMID:15138153
  45. Two truncated isoforms of GHR mRNAs were detected in liver, skeletal muscle, and subcutaneous fat of mice. The ratio of GHR-truncated to GHR-full length mRNA was tissue specific and not affected by chronic excess or deficiency of GH. PMID:15165994
  46. targeted disruption of the GH receptor/GH-binding protein gene and caloric restriction act via overlapping, but distinct, mechanisms. PMID:15498882
  47. specific domains of the GHR regulate body growth and composition PMID:15601831
  48. GHR is subject to sequential proteolysis by metalloprotease and gamma-secretases, including PS1 PMID:15743767
  49. The lower fasting and postmeal plasma ghrelin levels in binge eaating disorder are consistent with lower ghrelin levels in obese compared to lean individuals. PMID:15867334
  50. Retention of ubiquitin-dependent endocytosis motif in N-terminal cytoplasmic domain of growth hormone receptor permits turnover of these mutant receptors because no dominant-negative phenotype is seen. PMID:16166215

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Secreted.; [Growth hormone-binding protein]: Secreted.
Protein Families
Type I cytokine receptor family, Type 1 subfamily
Tissue Specificity
Expressed in all tissues tested including, liver, heart, adipose tissue, mammary gland, testes, ovary, brain, kidney and muscle. Highest levels in liver.
Database Links

UNIGENE: Mm.3986

KEGG: mmu:14600

STRING: 10090.ENSMUSP00000069457

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products