MANNASLEQDPNHCSAINNSIPLIQGKLPTLTVSGKIRVTVTFFLFLLSTAFNASFLLKL QKWTQKRKKGKKLSRMKVLLKHLTLANLLETLIVMPLDGMWNITVQWYAGEFLCKVLSYL KLFSMYAPAFMMVVISLDRSLAITQPLAVQSNSKLEQSMISLAWILSIVFAGPQLYIFRM IYLADGSGPTVFSQCVTHCSFPQWWHQAFYNFFTFGCLFIIPLLIMLICNAKIIFALTRV LHQDPRKLQLNQSKNNIPRARLRTLKMTVAFATSFVVCWTPYYVLGIWYWFDPEMLNRVS EPVNHFFFLFAFLNPCFDPLIYGYFSL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Receptor for gonadotropin releasing hormone (GnRH) that mediates the action of GnRH to stimulate the secretion of the gonadotropic hormones luteinizing hormone (LH) and follicle-stimulating hormone (FSH). This receptor mediates its action by association with G-proteins that activate a phosphatidylinositol-calcium second messenger system.
Gene References into Functions
leptin's direct stimulatory actions on gonadotrope GnRHR correlate with a direct inhibition of expression of the posttranscriptional regulator MSI1. There also is a direct MSI1 interaction with 3'-UTR of Gnrhr mRNA.PMID:29228137
the age-dependent basal and regulated Gnrhr transcription could account for the initial blockade and subsequent activation of the reproductive system during development.PMID:27569529
GnRH-GnRHR system is not essential for growth or motor/sensory/orientation behavior during the first month of life prior to puberty onset. The lack of the GnRH-GnRHR axis, however, did affect females resulting in reduced subcutaneous inguinal fat pad weight and increased glucose with possible insulin resistance.PMID:28346489
His305 of the GnRH receptor forms two distinct interactions that determine binding to GnRH and couple agonist binding to the conserved transmembrane domain network that activates GPCRs.PMID:25583361
Data confirm that Gnrhr mRNA and protein are expressed in ovaries, granulosa cells, cumulus cells, and oocytes.PMID:23913446
Msx1 functions as a negative regulator early in pituitary development by repressing the gonadotrope-specific alphaGSU and GnRHR genes.PMID:23371388
These results suggest decreased GnRH receptor signaling in the mutant animal, compared with wild type.PMID:22918878
GnRHR neurons were found in different brain areas. Many GnRHR neurons were identified in areas influencing sexual behaviorsPMID:21303944
A comprehensive knowledgebase of the GnRHR signaling in the LbetaT2 cell, was curated.PMID:20592162
Null Gnrhr mice had small sexual organs, low levels of FSH, LH, and steroid hormones, failure of sexual maturation, infertility, and inability to respond to exogenous GnRH.PMID:20068010
GnRH and dex synergistically activate the endogenous GnRHR promoter in L beta T2 cellsPMID:19812390
role of regulatory elements and their cognate transcription factors in transactivation of the mGnRHR genePMID:12145309
an intact AP-1 element is necessary for GnRH responsiveness of the GnRHR gene; results suggest a critical role for JNK in mediating GnRH regulation of the GnRHR genePMID:12586760
the GnRH receptor activating sequence is a composite regulatory element whose functional activity is dependent on the organization of a multi-protein complex consisting of Smads, AP-1 and a member of the forkhead family of DNA binding proteinsPMID:12943993
Results suggest that pituitary homeobox 1 (Pitx-1) can direct transactivation of the mouse gonadotropin-releasing hormone receptor gene, in part by DNA binding and in part by an action of Pitx-1 as a cofactor for AP-1 [Pitx-1].PMID:15226417
NF-Y and Oct-1 bind to the SURG-1 element to direct basal and GnRH-stimulated expression of the mGnRHR genePMID:15388790
An autosomal-recessive mutation leucine to proline that causes hypogonadotrophic hypogonadism was isolated during an N-ethyl-N-nitrosourea mutagenesis screen in mice.PMID:15625238
Regulatory elements defined as the activin/TGFbeta-responsive "enhanceosome" were show in the promoter of the murine GnRHR gene.PMID:15637149
study demonstrates a functional role for LHX3 in the regulation of the GnRH receptorPMID:15705775
there are species-specific dominant negative receptor trafficking effects of the GnRHR between human, rat and mousePMID:15886197
co-transfection of DAN markedly inhibited the synergistic activation of GnRH and activin on GnRH receptor gene expression thus implicating DAN as a novel autocrine/paracrine factor that modulates GnRH function in pituitary gonadotropes.PMID:17914181
These data implicate the clock genes as important factors controlling GnRHR expression in murine gonadotrope cells.PMID:17928134
We have defined the proportion of GnRHRs at the cell surface.PMID:18252959
NeuroD1 and Mash1 temporally regulate GnRH receptor gene expression in immortalized mouse gonadotrope cells.PMID:18760324
The two most proximal homeodomain-binding sites in the murine GnRHR promoter may regulate the promoter in a developmentally dependent fashion.PMID:19333792
Pulsatile and sustained gonadotropin-releasing hormone (GnRH) receptor signaling: does the Ca2+/NFAT signaling pathway decode GnRH pulse frequencyPMID:19858197