MRRLWGPGTPFLALLLLVSIKQVTTGSLLEETVQKWAQYKETCLKDLLEKPSGVFCNGTF DKYVCWPHSFPGNVSVPCPSYLPWWNKESPGRAYRHCLAQGTWQKQENSTDTWQDESECS ENHSFKQNVDHYHHTLLSTLQLMYTVGYSLSLISLFLALTLFLFLRKLHCTRNYIHMNLF ASFILRALVVLVKDMVFYNSYSRRPDSESGWMSYLSEISASCRSVQVLLHYFVGTNHLWL LVEGLYLHALLEPTVLPERRLWPKYLVVGWAFPMLFVIPWIFVRASLENTGCWAVNENKK IWWIIRGPILLCVTVNFFIFLKILKLLISKFRAHQMCFRDYKYRLAKSTLLLILLMGVHE FLFTFFTDDQVQGFSRLIRLFIQLTLSSFHGFLVALQYGFASREVKAELRKTWGRFLLAR HWGCRACVLGKNFRFLGKCSKKLSEGDGAETLQKLQSSGVSSHLTAGNLRDHGAQPHRGR GAWPRASSLSESSEGDFTLANTMEEILEESEI
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
This is a receptor for glucagon-like peptide 2. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Gene References into Functions
These results suggest that PAS-CPPs-GLP-2 is effective for i.n. delivery to the brain, and may be useful in the clinical treatment of major depressionPMID:27894924
Results suggest that GLP-2 protected and improved memory function in LPS-treated mice, and also had anxiolytic effects due to changes in the 5-HT system.PMID:25481797
Report gastrointestinal GLP-2 receptor andl limited utility of GLP-2 in the management of inflammatory intestinal disorders.PMID:24875097
GLP-2 plays a key physiological role in the control of hepatic glucose production through activating PI3K-dependent modulation of membrane excitability and nuclear transcription of POMC neurons in the brain.PMID:23823479
Data suggest a role for endogenous GLP2 (glucagon-like peptide-2) and GLP2R in adaptation of mucosa of duodenum and jejunum to high-fat diet; results suggest dysregulation of GLP2/GLP2R signaling in obesity due to prolonged high-fat diet.PMID:23308022
The data indicated that CNS GLP-2 receptor plays a physiological role in the control of feeding behavior and gastric emptying and that this is mediated probably through the melanocortin system.PMID:22829581
Data suggest that the Vip gene is not required for induction of a gene expression program linked to small bowel growth after enhancement of GLP-2 receptor signaling.PMID:22535770
Disruption of the murine Glp2r impairs Paneth cell function and increases susceptibility to small bowel enteritisPMID:22253424
Data show that the GLP-2R is expressed by inhibitory and excitatory neurons, and inhibits the muscle contractility likely by decreasing cholinergic neurotransmission and increasing nitric oxide production.PMID:21752156
GLP-2R is not critical for the stimulation/suppression of glucagon secretion or glucose homeostasis in normal or lean diabetic mice. In obese mice GLP-2R signaling mediates the normal islet adaptive response required to maintain glucose homeostasis.PMID:20546737
Glucagon-like peptide-2 potentiates L-type voltage-gated Ca(2+) channels activity through activating cAMP-dependent protein kinase A signaling, partially stimulating glucose uptake by primary cultured hippocampal neurons.PMID:19920220
Glp2r and ErbB pathways as essential components of the signaling network regulating the adaptive mucosal response to refeeding in the mouse intestine.PMID:20226187
GLP-2 in the gut acts by activating receptors on the subepithelial myofibroblasts, causing the release of growth factors, which in turn stimulate intestinal growthPMID:15544847