Recombinant Mouse Gastrin/cholecystokinin type B receptor (Cckbr)

Code: CSB-CF004773MO
Size:
20μg
20μg100μg
US$5884
Quantity:
Express system: in vitro E.coli expression system
Species: Mus musculus (Mouse)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
Cckbr
Uniprot NO.
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
1-453
Target Protein Sequence
MDLLKLNRSLQGPGPGSGSSLCRPGVSLLNSSSAGNLSCETPRIRGTGTRELELTIRITL YAVIFLMSVGGNVLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTF IFGTVICKAVSYLMGVSVSVSTLNLAAIALERYSAICRPLQARVWQTRSHAARVILATWL LSGLLMVPYPVYTVVQPVGPRILQCMHLWPSERVQQMWSVLLLILLFFIPGVVMAVAYGL ISRELYLGLRFDGDNDSETQSRVRNQGGLPGGAAAPGPVHQNGGCRHVTSLTGEDSDGCY VQLPRSRLEMTTLTTPTTGPGPGPRPNQAKLLAKKRVVRMLLVIVLLFFVCWLPVYSANT WRAFDGPGARRALAGAPISFIHLLSYTSACANPLVYCFMHRRFRQACLDTCARCCPRPPR ARPRPLPDEDPPTPSIASLSRLSYTTISTLGPG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Receptor for gastrin and cholecystokinin. The CCK-B receptors occur throughout the central nervous system where they modulate anxiety, analgesia, arousal, and neuroleptic activity. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.
Gene References into Functions
  1. Our data suggest a progression model for BE to EAC in which CCK2R+ progenitor cells, stimulated by hypergastrinemia, proliferate to give rise to metaplasia and dysplasia. PMID:27448962
  2. CCKBR and D5R synergistically interact in the kidney, which may contribute to the maintenance of normal sodium balance following an increase in sodium intake PMID:26751218
  3. findings provide novel evidence that Cnr1 contributes to cued fear expression via an interaction with the CCKB receptor. PMID:25176168
  4. CCK2R labels +4 antral stem cells that can be activated and expanded by progastrin, thus identifying one hormonal trigger for gastric stem cell interconversion and a potential target for gastric cancer chemoprevention and therapy. PMID:24951258
  5. cholecystokinin receptor-2 has a role in stress-triggered fear memory and anxiety in the mouse PMID:21209861
  6. shift of breakpoint on Arrhenius plot established in CCK(2) receptor-deficiency confirms that such kind of alteration in Na(+),K(+)-ATPase temperature dependence is likely related to the homeostatic adjustment of altered function of the sodium pump. PMID:20058075
  7. Environmental enrichment has beneficial effects in neuropathic conditions and reinforce the causal link between CCK(2) receptors, mechanical sensitivity and the development of CCI-induced hypersensitivity. PMID:19840831
  8. The gastrin receptor promotes pancreatic growth in transgenic mice. PMID:11854616
  9. the targeted genetic suppression of cholecystokinin B receptor increased the sensitivity of pre- and post-synaptic dopamine D(2) receptors PMID:12637032
  10. Na-pump kinetic properties are differently altered in the brain regions of mice deficient in this receptor PMID:12763910
  11. These results suggest that mice lacking the CCK2 receptor gene are less anxious than normal mice. PMID:15013032
  12. possibility that the C-terminal tyrosine 438 of the CCK2 receptor associates with the SH2 domains of phospholipase C gamma1 was examined PMID:15196926
  13. The targeted mutation of CCK(2) receptors selectively antagonised the behavioural changes induced by the individual housing in females, but not in male mice. PMID:15325774
  14. This study suggests that not only pain sensitivity, but also mechanical sensitivity and the development of neuropathic pain are regulated by antagonistic interactions between CCK and opioid systems. PMID:15355324
  15. CCK2R expression in pancreas of Elas-CCK2 mice leads to the activation of JAK2 and STAT3 PMID:15640156
  16. CCK2 receptors have roles in carcinogen-induced preneoplastic lesions formation in murine pancreatic acinar cells PMID:15688412
  17. CCK(2) receptor deficient mice displayed reduced anxiety compared to their wild-type littermates in the plus-maze test. This behavioural effect seems to be related, at least partly, to an increased tone of opioid system in the brain. PMID:16488027
  18. Deregulation of the Src/ERK pathway by the CCK2R might represent an early step that contributes to cell proliferation, formation of preneoplastic lesions and pancreatic tumor development. PMID:16874861
  19. The lack of development of up-regulation of Drd1 and Drd2 genes after repeated treatment with amphetamine probably explains the reduced place conditioning in CCK(2) receptor deficient mice. PMID:16916582
  20. CCK2 receptor activity plays a contributing regulatory role in the control of food intake. PMID:17122076
  21. Functional postsynaptic G-protein-coupled CCK B receptors are prevalent in neonatal rodent spinal cord. PMID:17581850
  22. Gene expression profiling indicates that elements of the immune response are not activated in Cckbr knockout mice following chronic constriction injury. PMID:18054398
  23. Data show that lacking cholecystokinin B receptors, housed in standard conditions are more anxious, display stronger restraint-induced analgesia and perform worse in the water maze when compared to corresponding wild-type littermates. PMID:18541314
  24. in juvenile animals when iron demand is high, circulating gastrin concentrations may alter iron status by a CCK2R-independent mechanism. PMID:18755804
  25. The H(2) receptor and gastrin receptor do not affect emergence of spasmolytic polypeptide (SP/TFF2)-expressing metaplasia (SPEM). The absence of H(2) receptor signaling causes a delay in the maturation of chief cells from mucous neck cells. PMID:19507031
  26. The results show that social stress increases alcohol intake in low alcohol preference C57BL/10 mice and suggest that CCK transmission may be involved in this effect. PMID:16205917

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products