Gjd2; Gja9; Gap junction delta-2 protein; Connexin-36; Cx36; Gap junction alpha-9 protein
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
1-321
Target Protein Sequence
MGEWTILERLLEAAVQQHSTMIGRILLTVVVIFRILIVAIVGETVYDDEQTMFVCNTLQP GCNQACYDRAFPISHIRYWVFQIIMVCTPSLCFITYSVHQSAKQRERRYSTVFLALDRDP AESIGGPGGTGGGGSGGSKREDKKLQNAIVNGVLQNTETTSKETEPDCLEVKELTPHPSG LRTAARSKLRRQEGISRFYIIQVVFRNALEIGFLVGQYFLYGFSVPGLYECNRYPCIKEV ECYVSRPTEKTVFLVFMFAVSGICVVLNLAELNHLGWRKIKLAVRGAQAKRKSVYEIRNK DLPRVSVPNFGRTQSSDSAYV
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.
Gene References into Functions
data suggest a possible contribution of Cx36 to ALS pathogenesis amyotrophic lateral sclerosisPMID:29246791
Results indicate that even though Cx36 may be required for electrical coupling of suprachiasmatic nucleus cells, it does not affect coupling of molecular clock gene rhythms. Thus, electrical coupling of neurons and coupling of circadian clock gene oscillations can be regulated independently in the suprachiasmatic nucleus.PMID:28576728
In mice, strain differences were found, such that punctate labelling for Cx36 was differentially distributed in the molecular layer of C57BL/6 vs. CD1 mice. Cx36-puncta were localized to processes of stellate cells and other cerebellar interneurons. The vast majority of Cx36-puncta co-localized with Cx45-puncta, which in turn was associated with the scaffolding protein zonula occludens-1.PMID:28561933
Cx36 deletion therefore disrupts normal regulation of sympathetic outflow with effects on cardiovascular parameters.PMID:28533325
Deletion of connexin 36 increased the frequency and shifted the amplitude distributions of miniature inhibitory post synaptic potentials.PMID:26864476
retinal aberrant activity was reduced in the rd10/Cx36KO mice compared to rd10 controls, a direct evidence for involvement of Cx36-containing gap junctions in generating aberrant activity in RD.PMID:26005040
The results suggest that electrical synapses formed by Cx36-containing gap junctions occur in most of the widely distributed centers of the auditory system.PMID:26188286
The resilts of this study showed that the phosphorylation state of Cx36 as a key biochemical step at the crossroad of light-dark and circadian regulatory pathways that control photoreceptor coupling.PMID:26241696
The magnitudes of the 2f1-f2 distortion products were not different between Cx36 knockout and wild-type mice, suggesting similar cochlear function in the two groupsPMID:25891643
Mg(2+)-dependent synaptic plasticity of Cx36-containing electrical synapses could underlie neuronal circuit reconfiguration via changes in brain energy metabolism that affects neuronal levels of intracellular ATP and [Mg(2+)]i.PMID:25135336
Gene expression data indicate that EPCs, or their soluble products, modulate the expression of the beta-cell surface molecule connexin 36 and affect glucose-stimulated insulin release in vitro.PMID:24069942
Some neurons exhibit at least two discriminatory mechanisms for assembling Cx36 into gap junctions.PMID:24463820
The Cx36 was expressed in the mouse carotid body and in the intestine at ileum and colon level.PMID:22897942
The results indicate the presence of Cx36-containing gap junctions in the sexually dimorphic dorsomedial nucleus and dorsolateral nucleus of both male and female rodentsPMID:24304165
The genetic deletion of the GJ subunit Cx36 increased cell survivability by approximately 50% under excitotoxic condition.PMID:25100592
Data (including data from studies in knockout mice) suggest that Cx36/Gjd2 gap junction channels are necessary for full up-regulation of insulin secretion by islet cells; mice with defective Cx36/Gjd2 expression exhibit glucose intolerance.PMID:24735890
knockout of Cx36 in mice with ATP-insensitive KATP channels restores glucose homeostasis and normal insulin secretion.PMID:24458355
Because Cx36 expression and function is reduced in type 2 diabetes, the resulting defect in intraislet blood cell flow regulation may also play a significant role in diabetic pathology.PMID:24326425
This study demonistrated that regulation of interneuron excitability by gap junction which containing Gjd2 coupling with principal cells in mice.PMID:24185427
disruption of connexin36-mediated rod-cone coupling does not stop, delay or spatially restrict secondary cone degeneration and suggest that the gap junction-mediated bystander effect does not contribute to the progression of RP.PMID:23468924
Deletion of connexin 36 is neuroprotective, resulting in a better functional outcome and decreased infarct size after cerebral ischemia.PMID:22960118
The intercellular synchronization of Ca2+ oscillations evaluates Cx36-dependent coupling.PMID:22848521
These results indicate that gap junctions formed by Cx36 in spinal cord are required for maintenance of presynaptic inhibition, including the regulation of transmission from Ia muscle spindle afferents.PMID:22615430
the differences in Purkinje cell complex spike activity between wild type and cx36 knockouts likely reflect the loss of electrical coupling of inferior olive cellsPMID:17853112
Results provide a context in which to examine functional relationships between these proteins at Cx36-containing electrical synapses in brain.PMID:22722764
The data identify Cx36 as a novel early marker of beta cells and as a target of Beta2/NeuroD1, which is essential for beta-cell development and differentiation.PMID:22729650
It was concluded that connexin-36 gap junctions regulate the in vivo dynamics of insulin secretion, which is important for glucose homeostasis. Coordinated pulsatility of individual islets enhanced first-phase elevation and second-phase pulses of insulin.PMID:22511206
Data suggest that gap junction coupling of beta-cells mediated by Cx36 is impaired in prediabetic mice (induced along with obesity by high-fat diet); prediabetic mice exhibit decrease in islet Cx36 and glucose-stimulated insulin secretion.PMID:22569071
Connexin 36 is expressed in beta and connexins 26 and 32 in acinar cells at the end of the secondary transition of mouse pancreatic development and increase during fetal and perinatal life.PMID:22505190
during development, acute activation of group II mGluRs causes up-regulation of Cx36 via post-transcriptional mechanismsPMID:22342304
Electrical transmission is supported by connexin36 (Cx36)-containing gap junctions at somato-somatic contacts of MesV neurons.PMID:22457486
both AF6 and MUPP1 are associated with Cx36-containing interneuronal gap junctions that form electrical synapses in adult rodent brainPMID:22211808
Cx36 deficiency in the mouse leads to reduced CaMKII levels in the striatum and behavioral changes in open-field activity, anxiety-related behavior in the light-dark box and one-trial object-place recognition.PMID:21889545
Cx36 decreases apoptosis & protects mouse beta cells against both cytotoxic drugs & cytokines in the islet environment at the onset of type 1 diabetes. Proinflammatory cytokines decreased its expression.PMID:22056383
We characterized connexin36 (Cx36)-expressing neurons of the adult rat somatosensory cortexPMID:21467210
Data suggest that learning and memory deficiencies in Cx36 knockout mice are due to deficiencies in LTP mechanisms.PMID:21798314
elimination of electrical synapses formed by connexin36 altered inhibitory efficacy and caused frequency facilitation of inhibition consistent with a decreased GABA release in the inhibitory networkPMID:21804029
findings demonstrate the behavioral relevance of Cx36 gap junction-mediated electrical coupling between GABA neurons in mature animalPMID:21638336
The cx36 strongly modulate the firing pattern of individual RGCs, ensuring strongly correlated firing between nearby RGCs and normal patterning of retinogeniculate projections.PMID:21734291
in the 4-aminopyridine model of epilepsy in vitro, connexin36 is not critical for the generation of epileptiform discharges in GABAergic networksPMID:21300748
Results identify a motif within connexin 36 that may interact with other trafficking or scaffold proteins and thereby be responsible for its incorporation into electrical synapses.PMID:20510366
Cx36 is the predominant subunit of gap junctions in the proximal mouse retina, expressed by most ganglion cell subtypes, and thereby likely plays a major role in the concerted activity generated by electrical synapsesPMID:20058323
Cx36 plays a role in the generation of certain forms of network synchronisation in the hippocampusPMID:12042356
Results indicate that connexins 26 and 36 are not present in mouse horizontal cells and therefore cannot contribute to feedback inhibition or horizontal cell coupling.PMID:12064619
spatial and temporal expression of connexin36 protein in neurons of the central nervous systemPMID:12107497
Expression of mRNA encoding cx36 is observed in the olfactory epithelium mainly in ventral and lateral regions of the turbinates.PMID:12687708
connexin 36 expression is regulated by the transcriptional repressor NRSF/RESTPMID:14565956
There is a molecular link between Cx36 and the stimulus-secretion pathway leading to insulin secretion.PMID:14681053
Connexin36 is localized to beta cells of pancreatic islets.PMID:14980497
Adequate but not excessive levels of Cx36 allowed for recover of normal insulin secretion in response to various secretagogues.PMID:15023528
Show
More
Hide
All
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.