Recombinant Mouse Gap junction alpha-1 protein (Gja1)

CSB-CF009443MO
Size:
20μg
20μg100μg
US$5345
Quantity:
Express system: in vitro E.coli expression system
Species: Mus musculus (Mouse)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Orders can only be placed from within the U.S.

Product Details

Target Names
Gja1
Uniprot NO.
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
1-382
Target Protein Sequence
MGDWSALGKLLDKVQAYSTAGGKVWLSVLFIFRILLLGTAVESAWGDEQSAFRCNTQQPGC ENVCYDKSFPISHVRFWVLQIIFVSVPTLLYLAHVFYVMRKEEKLNKKEEELKVAQTDGV NVEMHLKQIEIKKFKYGIEEHGKVKMRGGLLRTYIISILFKSVFEVAFLLIQWYIYGFSL SAVYTCKRDPCPHQVDCFLSRPTEKTIFIIFMLVVSLVSLALNIIELFYVFFKGVKDRVK GRSDPYHATTGPLSPSKDCGSPKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNY NKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDSQNAKKVAAGHELQPLAIVDQ RPSSRASSRASSRPRPDDLEI
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Description

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function
Gap junction protein that acts as a regulator of bladder capacity. A gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. Negative regulator of bladder functional capacity: acts by enhancing intercellular electrical and chemical transmission, thus sensitizing bladder muscles to cholinergic neural stimuli and causing them to contract. May play a role in cell growth inhibition through the regulation of NOV expression and localization. Plays an essential role in gap junction communication in the ventricles.; Connexin 43 is possibly the ATP-induced pore of mouse macrophages.
Gene References into Functions
  1. the levels of mRNAs encoding Connexin43 or Connexin45 were not or were only marginally affected, respectively, by Clmp deficiency, the absence of CLMP caused a severe reduction of both proteins in smooth muscle cells of the intestine and of Connexin43 in the ureter. PMID:29361518
  2. Gap junction composed of Cx43 inhibits I-10/cisplatin cell invasion and migration. PMID:29571253
  3. specific deletion of astroglial Cx43 in APP/PS1 mice improved cognitive dysfunction by decreasing astrogliosis and increasing synaptic function without affecting amyloid plaque formation or the inflammatory response PMID:30031059
  4. work directly links phosphorylation of Cx43 to astrocytic coupling and apoptosis and ultimately to vascular regeneration in retinal ischemia. This study reveals that targeting Cx43 phosphorylation in astrocytes is a potential direction for the treatment of proliferative retinopathies. PMID:29891713
  5. Study confirmed the disruption of coupling between radial glia-like cells and astrocytes in the hippocampus of Cx43G138R mice. Proliferative activity and neurogenesis in the dentate gyrus were significantly decreased in the mutant mouse line, indicating that functional Cx43 channels are essential for proper adult neurogenesis. PMID:28689039
  6. Coxsackievirus B3 infection reduced Cx43 expression by elevating miR-1 level in mouse viral myocarditis. PMID:30097120
  7. oxytocin, PGE2, and Cx43 are increased in the uterine smooth muscle of pregnant mice with Yimu San (YMS), a Chinese veterinary medicine micro mist PMID:29119736
  8. our findings suggest that the role of Cx43 in response to H2O2 stress is dependent on the activation of AMPK signaling pathways and regulates ROS production and cell necrosis. PMID:29279848
  9. The tenotomy mice treated with Cx43 shRNA injection indicated a reduction in total heterotopic ossification (HO) volume at 4 and 8 weeks after injury. PMID:27849058
  10. The treatment of Salmonella enterica serovar choleraesuis or resveratrol in murine melanoma cells demonstrated the ability of reducing IDO1 production through upregulating Cx43. PMID:29104473
  11. At 3days after the first tamoxifen injection, Akt1(-/-)/iAkt2 KO hearts showed decreased expression of connexin43 (Cx43) and connexin-interacting protein zonula occludens-1 (ZO-1). Furthermore, Akt1/2 silencing significantly decreased both Cx43 and ZO-1 expression PMID:29378301
  12. we confirmed that Th1 cell-conditioned medium decreased Cx43 protein levels in mixed glial cell cultures. These findings suggest that Th1 cell-derived IFNg activates microglia to release IL-1b that reduces Cx43 gap junctions in astrocytes. Thus, Th1-dominant inflammatory states disrupt astrocytic intercellular communication and may exacerbate multiple sclerosis. PMID:27929069
  13. Results suggest that gap junctions are present not only among tanycytes, but also between tanycytes and the axons of hypophysiotropic neurons. Cx43 hemichannels may also facilitate the transport between tanycytes and extracellular fluids, including the cerebrospinal fluid, extracellular space of the median eminence and bloodstream. PMID:28803831
  14. The most aggressive trans-differentiated (phenotypically epithelial) cell strain, NIH3T3x8x3 acquired metastatic phenotypic changes accompanied ~40% reduction in endogenous or radiation-induced connexin-43 expression/mitochondrial translocation. Parental (NIH3T3) and reverting (NIH3T3x12) strains lacked hyperradiosensitivity and had distinct radiation-induced Cx43 translocation into mitochondria. PMID:29154903
  15. Cx43 is up-regulated in the dentate gyrus following traumatic brain injury and is expressed on vimentin-positive cells in the subgranular zone. Treatment of cultured cells with alpha-connexin Carboxyl Terminal (alphaCT1) peptide substantially reduced proliferation and increased caspase 3/7 expression on NSPCs in a dose-dependent manner. alphaCT1 exposure also reduced overall expression of Cx43 and phospho (p)-Serine368. PMID:28648814
  16. the Gja1 gene showed an upregulated profile in the Light and Inflexible ethanol drinkers when compared to the Control group. PMID:28714806
  17. The mosaic of Cx43/Cx45-puncta along cerebral cortex Bergmann glial processes raises the possibility of differential regulation of coupling between these processes via separate but adjacent Cx43-containing and Cx45-containing gap junctions channels having different permeability and other biophysical properties or may contribute to coupling between Bergmann glia and Purkinje cells. PMID:28561933
  18. These data demonstrate non-myocytes in the scar are electrically coupled to myocytes, and coupling depends on Cx43 expression. PMID:27244564
  19. MIF is involved in the pathogenesis of AF, probably by down-regulating the protein and gene expression of Cx43 via ERK1/2 kinase activation PMID:28429502
  20. The ELF-EMFs did not affect C2C12 myoblast viability or proliferation rate. Conversely, at ELF-EMF intensity in the mT range, the myogenic process was accelerated, through increased expression of MyoD, myogenin, and connexin 43 PMID:28607928
  21. These findings suggest that the proteolytic cleavage of the CTD under pathological conditions, such as under the activation of metalloproteinases during tissue injury or inflammation, may account for the deleterious effects of Cx43 in cartilage and bone disorders such as osteoarthritis. PMID:27682878
  22. Neonatal hypothyroidism affects germ cell survival and proliferation in prepubertal P mice via impaired testicular glucose homeostasis and decreased expression of connexin 43. PMID:28471544
  23. In vivo muCT analysis of cortical bone at age 1 and 3 months confirmed increased thickness in Sost-/-mice, but revealed no cortical abnormalities in single Gja1+/-or Sost+/-mice PMID:29149200
  24. the presence of the C-terminal domain of Cx43 in osteocytes and other cell types is important to maintain normal structure and mechanical integrity of bone. PMID:27113527
  25. The astroglial targeted connexin43 gene knocking-out in APPswe/PS1dE9 mice allowed to diminish gliotransmitter release and to alleviate neuronal damages, reducing oxidative stress and neuritic dystrophies in hippocampal neurons associated to plaques. PMID:27391799
  26. Thus we propose that Cx43 might enhance the activation of Nrf2/ARE pathway by means of inhibiting c-Src activity to hinder the nuclear export of Nrf2, and then reduce expression of FN, ICAM-1 and TGF-b1, ultimately attenuating renal fibrosis in diabetes. PMID:27840317
  27. Upon the induction of autophagy by dexamethasone (Dex), connexin 43 (Cx43) was internalized into autophagosome/autolysosomes and degraded by autophagy. PMID:27127181
  28. Disruption of the Cx43/miR21 pathway leads to osteocyte apoptosis and increased osteoclastogenesis with aging. PMID:28317237
  29. Down-regulation of Cx43 follows increased CELF1 expression in the dilated cardiomyopathy heart. PMID:28874395
  30. increased expression promotes renal inflammation and glomerular damage PMID:28667079
  31. weightlessness simulated by using a random position machine promoted the retention of Cx43 in the Golgi apparatus PMID:26945892
  32. show that knockout of the gap junction subunit connexin 43 in astrocytes throughout the brain causes excessive sleepiness and fragmented wakefulness during the nocturnal active phase. PMID:28867552
  33. For the first time in astrocytes, we demonstrated that hemichannel activity depends on the intracellular calcium concentration and is associated with D-serine release. Blocking hemichannel activity reduced the LTP of these excitatory synaptic currents triggered by high-frequency stimulation. These observations may be particularly relevant in the PFC, where D-serine and its converting enzyme are highly expressed. PMID:28821660
  34. These findings imply that enteric glia activation via Cx43 and P2X receptors is a significant modulator of morphine-related inflammation and constipation. PMID:28280004
  35. Lower expression of connexin43 in vascular cells contributes to impaired vasomotor control in experimental diabetes. PMID:28674171
  36. Blocking of connexin32 or connexin43 hemichannels decreased serum levels of pro-inflammatory cytokines, and reduced acetaminophen-induced liver injury. PMID:28687253
  37. deletion of connexin 43 (Cx43, also known as GJA1) in astrocytes inhibits OPC proliferation by decreasing matrix glucose levels without impacting on OPC hemichannel properties, a process that also occurs in corpus callosum from acute brain slices. PMID:27006115
  38. Relative to Gja1(+/-) controls, male Gja1(-/K258Stop) mice have a cortical bone phenotype that is remarkably similar to those reported for deletion of the entire Cx43 gene in osteoblasts. PMID:28049723
  39. S368 of connexin 43 (also known as GJA1) is phosphorylated on gap junctions and connexosomes, whereas connexin 43 residue S262 is phosphorylated only on some connexosomes. PMID:28202692
  40. a plaque accretion defect as the primary manifestation of myosin VI loss in Cx43 homeostasis, is reported. PMID:28096472
  41. Findings demonstrate that spinal cord injury activates astrocyte sigma-1 receptors leading to increases in the expression of the gap junction protein, connexin 43 and astrocyte activation in the lumbar dorsal horn, and ultimately contribute to the induction of bilateral below-level mechanical allodynia. PMID:27567941
  42. beige adipocytes display an increased cell-to-cell coupling via connexin 43 (Cx43) gap junction channels. PMID:27626200
  43. the expression of Cx43 is specifically required in lymphatic endothelial cells for normal development of Lymphatic valves. PMID:27899284
  44. This study showed that Gja1 may act downstream of cAMP-PKA signal to mediate the effects of Acvr1 on the differentiation of uterine stromal cells through targeting Hand2. PMID:28219934
  45. Results indicate that pre- and peri-implantation development does not require connexin43 (Cx43) and connexin45 (Cx45). PMID:27172058
  46. no statistically significant difference in connexin43 expression between fetal day 13 mice and adults PMID:28296544
  47. Cx43 can communicate cylic AMP (cAMP) between cells and, more importantly, that the communicated cAMP is sufficient to impact signal transduction cascades and the expression of key bone effector molecules between interconnected cells. PMID:27156839
  48. The results identify new protein-protein interactions between AIF-Cx43, ETFB-Cx43 and AIF-ETFB as possible players in the regulation of the mitochondrial redox state. PMID:26915330
  49. Data show that in the presence of heterogeneous connexin 43 (Cx43) expression, ephaptic coupling can either prevent or promote conduction block (CB) depending on the Cx43 knockout (Cx43KO) content. PMID:26968493
  50. Insulin is cardioprotective against cryoinjury in diabetic mouse model and that this protection is associated with Cx43 gap junction function and phosphorylation in the mouse heart. PMID:27034963

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction. Endoplasmic reticulum.
Protein Families
Connexin family, Alpha-type (group II) subfamily
Tissue Specificity
Expressed in heart, non-sensory epithelial cells, and in fibrocytes of the spiral ligament and the spiral limbus. Expressed in bladder smooth muscle cells (at protein level). Expressed in astrocytes (at protein level).
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products