Home
Product
Protein
Transmembrane Proteins
Recombinant Mouse G-protein coupled receptor 84 (Gpr84)

Recombinant Mouse G-protein coupled receptor 84 (Gpr84)

Code: CSB-CF807541MO

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5458

Quantity:

Express system: in vitro E.coli expression system

Species: Mus musculus (Mouse)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Gpr84

Uniprot NO.

Q8CIM5

Alternative Names

Gpr84; G-protein coupled receptor 84

Species

Mus musculus (Mouse)

Source

in vitro E.coli expression system

Expression Region

1-396

Target Protein Sequence

MWNSSDANFSCYHESVLGYRYFAVIWGVAVAVTGTVGNVLTLLALAIRPKLRTRFNLLIA NLTLADLLYCTLLQPFSVDTYLHLHWRTGAVFCRIFGLLLFTSNSVSILTLCLIALGRYL LIAHPKLFPQVFSAKGIVLALVGSWVVGVTSFAPLWNVFVLVPVVCTCSFDRMRGRPYTT ILMGIYFVLGLSSVGVFYCLIHRQVKRAARALDQYGLHQASIRSHQVAGTQEAMPGHFQE LDSGVASRGPSEGISSEPVSAATTQTLEGDSSEAGGQGIRKAAQQIAERSLPEVHRKPRE TAGARRATDAPSEFGKVTRMCFAVFLCFALSYIPFLLLNILDARGRAPRVVHMVAANLTW LNSCINPVLYAAMNRQFRHAYGSILKRGPQSFRRFH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor for medium-chain free fatty acid (FFA) with carbon chain lengths of C9 to C14. Capric acid (C10:0), undecanoic acid (C11:0) and lauric acid (C12:0) are the most potent agonists. Not activated by short-chain and long-chain saturated and unsaturated FFAs. Activation by medium-chain free fatty acid is coupled to a pertussis toxin sensitive G(i/o) protein pathway. May have important roles in processes from fatty acid metabolism to regulation of the immune system.

Gene References into Functions

GPR84 functions as a negative regulator of osteoclastogenesis by inhibiting NF-kappaB and MAPK signaling pathways. PMID:28574596
We conclude that GPR84 plays a beneficial role in amyloid pathology by acting as a sensor for a yet unknown ligand that promotes microglia recruitment, a response affecting dendritic degeneration and required to prevent further cognitive decline. PMID:25637481
We found that lipopolysaccharide-stimulated GPR84 knockout macrophages exhibited attenuated expression of several proinflammatory mediators. PMID:26063927
As GPR84 plays a role in the biology of myeloid cells, it could be relevant to consider the existence of this mutation when choosing a mouse model to study immune processes, and to consider reevaluating data obtained using such strains. PMID:23616478
primary stimulation of T cells with anti-CD3 resulted in increased interleukin-4 but not interleukin-2 or interferon -gamma production in GPR84(-/-) mice compared to wild-type mice PMID:15993493
in mice suffering from endotoxemia, microglia express GPR84 in a strong and sustained manner PMID:17390309

Hide All

Subcellular Location

Cell membrane; Multi-pass membrane protein.

Protein Families

G-protein coupled receptor 1 family

Tissue Specificity

Expressed predominantly in hematopoietic tissues. Expressed mainly in the bone marrow with transcripts also detected in spleen, the lymph node, liver and the lung.

Database Links

UNIGENE: Mm.160369

KEGG: mmu:80910

STRING: 10090.ENSMUSP00000078753

Promotions