GSPREDFRFCGQRNQTQQSTLHYDQSSEPHIFVWNTEETLTIRAPFLAAPDIPRFFPEPR GLYHFCLYWSRHTGRLHLRYGKHDYLLSSQASRLLCFQKQEQSLKQGAPLIATSVSSWQI PQNTSLPGAPSFIFSFHNAPHKVSHNASVDMCDLKKELQQLSRYLQHPQKAAKRPTAAFI SQQLQSLESKLTSVSFLGDTLSFEEDRVNATVWKLPPTAGLEDLHIHSQKEEEQSEVQAY SLLLPRAVFQQTRGRRRDDAKRLLVVDFSSQALFQDKNSSQVLGEKVLGIVVQNTKVTNL SDPVVLTFQHQPQPKNVTLQCVFWVEDPASSSTGSWSSAGCETVSRDTQTSCLCNHLTYF AVLMVSSTEVEATHKHYLTLLSYVGCVISALACVFTIAAYLCSRRKSRDYTIKVHMNLLS AVFLLDVSFLLSEPVALTGSEAACRTSAMFLHFSLLACLSWMGLEGYNLYRLVVEVFGTY VPGYLLKLSIVGWGFPVFLVTLVALVDVNNYGPIILAVRRTPERVTYPSMCWIRDSLVSY VTNLGLFSLVFLFNLAMLATMVVQILRLRPHSQNWPHVLTLLGLSLVLGLPWALVFFSFA SGTFQLVILYLFSIITSFQGFLIFLWYWSMRFQAQGGPSPLKNNSDSAKLPISSGSTSSS RI
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Receptor involved in cell adhesion and probably in cell-cell interactions. Mediates cell matrix adhesion in developing neurons and hematopoietic stem cells. Receptor for collagen III/COL3A1 in the developing brain and involved in regulation of cortical development, specifically in maintenance of the pial basement membrane integrity and in cortical lamination. Binding to the COL3A1 ligand inhibits neuronal migration and activates the RhoA pathway by coupling to GNA13 and possibly GNA12. Plays a role in the maintenance of hematopoietic stem cells and/or leukemia stem cells in bone marrow niche. Plays a critical role in tumourigenesis. Plays essential role in testis development.
Gene References into Functions
all hematopoietic stem cells (HSCs) in mouse bone marrow mononuclear cells express GPR56 protein on their surface and that GPR56 is a positive marker for HSCs.PMID:29225194
Collagen III protected beta-cells from cytokine-induced apoptosis, triggered increases in [Ca(2+)]i and potentiated glucose-induced insulin secretion from WT islets but not from Gpr56(-/-) islets. Deletion of GPR56 did not affect glucose-induced insulin secretion in vitro and it did not impair glucose tolerance in adult micePMID:29855662
Deletion of G-protein coupled receptor 56 (GPR56) in the mouse germline abrogated progastrin-dependent colonic mucosal proliferation and increased apoptosis.PMID:28380450
determine the crystal structure of the GPR56 extracellular domain.PMID:27657451
knockdown of Gpr56 delayed onset of HOXA9/MEIS1-induced AMLPMID:27063597
GPR56 is a cell-autonomous regulator of oligodendrocyte developmentPMID:25607655
Although GPR56 is abundantly and selectively expressed by primitive HSPCs, its high level expression is largely dispensable for steady-state and regenerative hematopoiesis.PMID:25840412
we knocked down GPR56 in cardiomyocytes and found that GPR56 promoted Ang II-induced cardiomyocyte hypertrophy and it contributed to PCBP2 effects on cardiomyocyte hypertrophyPMID:26116532
Data show that Gpr56, a G-coupled protein receptor, is required for hematopoietic cluster formation during transdifferentiation process in endothelial to hematopoietic cell transition (EHT).PMID:25547674
These data illustrate a signaling pathway through GPR56 which regulates muscle hypertrophy associated with resistance/loading-type exercise.PMID:25336758
adhesion G protein-coupled receptor GPR56-mediated RhoA activation induced by collagen III stimulationPMID:24949629
Role for TG2 in GPR56-mediated melanoma inhibition. The uncovered antagonistic relationship between GPR56 and TG2 proposes a mechanism by which extracellular matrix accumulation/crosslinking in tumors may be reversed.PMID:24356421
GPR56 functions together with alpha3beta1 integrin in regulating cerebral cortical development.PMID:23874761
We revealed that GPR56 is expressed in multiple cell types in the preplate, marginal zone, subventricular zone, and ventricular zone in the developing cerebral cortexPMID:22351047
GPR56 mutations cause bilateral frontoparietal polymicrogyria via multiple mechanismsPMID:21349848
Data suggest that GPR56 might act to establish a spatial and/or temporal cue for asymmetric cord remodeling during male gonad development.PMID:20981830
preferential expression in neuronal progenitor cells of the cerebral cortical ventricular and subventricular zones duing periods of neurogenesisPMID:15044805
potential pleiotrophic role of secretin during embryonic developmentPMID:16888225
These findings suggest that the secretin receptor system has an important role in the central nervous system relating to social behaviorPMID:17008357
Mutation of the SCTR gene could lead to mild polydipsia and polyuriaPMID:17283064
mutations in GPR56 impair trafficking of the mutant protein to the plasma membrane, thus providing insights into how BFPP-associated mutations affect GPR56 functionPMID:17576745
These results define the biochemical properties of GPR56 protein, and suggest that the expression of GPR56 protein is suppressed in human pancreatic cancer cells.PMID:17932623
results indicate that GPR56 participates in the regulation of neural progenitor cells movement through the Galpha(12/13) and Rho signaling pathway, suggesting its important role in the development of the central nervous systemPMID:18378689
GPR56 regulates pial basement membrane integrity and cortical lamination.PMID:18509043
These studies establish a novel role for GPR56 in the adhesion of developing neurons to basal lamina molecules and suggest that this adhesion is critical for maintenance of the pia and proper cerebellar morphogenesis.PMID:19515912
Expressed in neural progenitor cells in fetal forbrain. Expressed in migrating neurons. Expressed in radial glial endfeet (at protein level). Expressed in peritubular myoid cells, Sertoli cells, and germ cells of the testis.