MESNYSIHLNGSEVVVYDSTISRVLWILSMVVVSITFFLGVLGNGLVIWVAGFRMPHTVTTIWYLNLALADFSFTATLPFLLVEMAMKEKWPFGWFLCKLVHIVVDVNLFGSVFLIALIALDRCICVLHPVWAQNHRTVSLARKVVVGPWIFALILTLPIFIFLTTVRIPGGDVYCTFNFGSWAQTDEEKLNTAITFVTTRGIIRFLIGFSMPMSIVAVCYGLIAVKINRRNLVNSSRPLRVLTAVVASFFICWFPFQLVALLGTVWFKETLLSGSYKILDMFVNPTSSLAYFNSCLNPMLYVFMGQDFRERFIHSLPYSLERALSEDSGQTSDSSTSSTSPPADIELKAP
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length
Tag Info
C-terminal 10xHis-tagged If you have specified tag type, please tell us and we will check if it's possible to develop.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from PBS, 6% Trehalose, pH 7.4.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
High affinity receptor for N-formyl-methionyl peptides (FMLP), which are powerful neutrophil chemotactic factors. Stimulates chemotaxis in immune cells to site of infection or tissue damage upon recognition of several ligands, such as FMLP, or ligand involved in cell damage, disease or inflammation. Receptor for the chemokine-like protein FAM19A5, mediating FAM19A5-stimulated macrophage chemotaxis and the inhibitory effect on TNFSF11/RANKL-induced osteoclast differentiation.
Gene References into Functions
virus infection with enterovirus 71 and H1N1 PR8 influenza virus results in increased FPR2 expression. Inhibition of STAT3 phosphorylation in virus-infected cells repressed the induction of FPR2, which led to a reduction in viral loads.PMID:29127186
this study shows that formyl peptide receptor activation inhibits the expansion of effector T cells and synovial fibroblasts and attenuates joint injury in models of rheumatoid arthritisPMID:29879657
The influx of leukocytes into the peritoneum of WT and mFpr2(-/-) mice was analyzed. We demonstrate that mFpr2 is specifically activated by phenol-soluble modulin (PSM) peptides, and they represent the first secreted pathogen-derived ligands for the mFpr2.PMID:28855276
Study showed significantly increased expression of FPR1 and FPR2, during differentiation of neural stem cells (NSCs). The activation of FPRs promotes NSCs to differentiate into neurons with more primary neurites and branch points and longer neurites per cell. Meanwhile, this activation also inhibits the differentiation of NSCs into astrocytes.PMID:28303030
activation of Fpr2 in bone marrow after WKYMVm treatment provides cardiac protection through mobilization of circulating angiogenic cells after myocardial infarction.PMID:27790799
we suggest that Fpr2-mediated signaling in follicular dendritic cells plays a key role in germinal center maintenance in Peyer's patchesPMID:27974458
FAM3D plays a role in gastrointestinal homeostasis and inflammation through its receptors FPR1 and FPR2.PMID:26966188
antagonist pretreatment or gene silencing of the RvD1 receptor, ALX/FPR2, abrogated the anti-inflammatory and pro-resolving actions of RvD1. These data indicate that RvD1 ameliorates IR-induced liver injury, and this protection is associated with enhancement of M2 polarization and efferocytosis via ALX/FPR2 activationPMID:27317426
a novel FPR2 agonist, the proteolytically stable alpha-peptide/beta-peptoid hybrid Lau-((S)-Aoc)-(Lys-betaNphe)6-NH2 (F2M2), showing comparable potency in activating human and mouse neutrophils by inducing a rise in intracellular Ca(2+) concentration and assembly of the superoxide-generating NADPH oxidase.PMID:27422818
We conclude that ANX-A1 is an important regulator of mast cell reactivity to compound 48/80 exerting a negative feedback effect through a mechanism that depends at least partly on the FPR receptorPMID:26803520
annexin A1- formyl peptide receptor 2 pathway mediated the insulin resistance of skeletal muscle, as well as systemic insulin sensitivity.PMID:25616869
Deficiency of formyl peptide receptor 2 is associated with increased inflammation and enhanced liver injury after LPS-stimulationPMID:24956481
AnxA1 and Fpr2 have a critical role in the manifestation of adrenal insufficiency in this LPS-induced model, through regulation of cholesterol ester storagePMID:25818588
Ldlr(-/-)xFpr2(-/-) mice exhibited delayed atherosclerosis development and less macrophage infiltration compared with Ldlr(-/-)xFpr2(+/+) mice.PMID:25341894
Compared with wild-type mice, Fpr2/3(-/-) animals exhibited exacerbation of disease severity, including hypothermia and cardiac dysfunction.PMID:25512512
Fpr1/2 are critical for normal healing of the sterile skin wound by mediating the first wave of neutrophil infiltration.PMID:24603667
FPR1 and FPR2 play an important role in the innate immune responses against Streptococcus pneumoniae within the central nervous system and the lack of the receptors leads to a dysregulation of the inflammatory response compared with wild-type mice.PMID:24863484
Oxidized low-density lipoprotein stimulates macrophages, resulting in chemotactic migration, TNF-alpha production, and foam cell formation via FPR2 signaling.PMID:24361884
During ischemia, neutrophil Fpr2/3 controls platelet/neutrophil aggregates with the rapid generation of circulating LXA4, which in turn modulates downstream vascular inflammatory responses evident during the reperfusion phase.PMID:23733341
FPR2 is not activated by lipoxin (LX)A; the molecular mechanism by which LXA functions still needs to be identified.PMID:23643932
FPR2 is critical in mediating homeostasis, inflammation, and epithelial repair processes in the colon.PMID:23454745
Results indicate that the AnxA1/FPR2 system has an important role in effecting the resolution of cerebral inflammation in sepsis and may provide a novel therapeutic target.PMID:22964301
The mechanism involved impaired early neutrophil recruitment to the liver with Fpr2 being sole receptor for neutrophils to sense Listeria chemoattractant signals and for production of bactericidal superoxide.PMID:23139859
These results suggest that Fpr2 plays an important role in host defense against implanted LLC by sustaining macrophages in an M1 phenotype with more potent antitumor activities.PMID:23139214
results suggest that microvascular endothelial cells express mFPR2 which can be upregulated by proinflammatory factors IL-1beta and LPS through JNK and NF-kappaB related signaling pathwaysPMID:21761148
The conclusions drawn from these experiments are that neither compound 43 nor LXA4 works as FPR2 agonists in neutrophils, findings of importance for a proper interpretation of results obtained with these compounds as regulators of inflammation.PMID:21535079
The recognition of Abeta by the formylpeptide chemotactic receptor 2 seems to be a starting point of the signaling cascade inducing an inflammatory state in AD.PMID:20456016
Studies show that inflammation was more marked in Fpr2(-/-) mice.PMID:20107188
This study reveals a critical role for mFPR2 in the progression of allergic airway inflammation and immune responses.PMID:20200280
By selectively up-regulating FPR2 in microglia, TNF alpha has the capacity to amplify host response in inflammatory diseases in the central nervous system.PMID:12270697
TLR9 may play an important role in promoting microglial recognition of Abeta42 by up-regulating the expression of the G-protein- coupled receptor mFPR2PMID:16219804
mouse neutrophils, which like macrophages and dendritic cells express Fpr2, responded to human and mouse F2L in both calcium flux and chemotaxis assaysPMID:17237393
the effect of IFN-g and its synergy with CD40L on mFPR2 expression in microglia was mediated in part by TNF-alpha; IFN-g and CD40L may profoundly affect microglial cell responses in the pathogenic process in which mFPR2 agonist peptides are elevatedPMID:17237425
IL-10 may affect the pathogenic process of Alzheimer's disease by up-regulating mFPR2 and thus favoring the recognition and internalization of Abeta(42) by activated microglial cellsPMID:17544285
TLR2 and NOD2 cooperate to up-regulate the expression of mFPR2 and therefore, may actively participate in the pathogenic processes of brain inflammation and neurodegenerative diseases.PMID:18299458
(Poly(I:C)), which is a specific TLR3 ligand, and Imiquimod (R837), which is a specific TLR7 ligand, when used alone, each increased MAPK-dependent functional mFPR2 expression in microglial cells.PMID:19559490
Show
More
Hide
All
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Primarily expressed in neutrophils. Not detected in vomeronasal neurons.