Home
Product
Protein
Transmembrane Proteins
Recombinant Mouse Follicle-stimulating hormone receptor (Fshr)

Recombinant Mouse Follicle-stimulating hormone receptor (Fshr)

Code: CSB-CF009021MO

Rate （N/A）
Review （0）

Size:

20μg100μg

US$7545

Quantity:

Express system: in vitro E.coli expression system

Species: Mus musculus (Mouse)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Fshr

Uniprot NO.

P35378

Species

Mus musculus (Mouse)

Source

in vitro E.coli expression system

Expression Region

18-692

Target Protein Sequence

CHHWLCHCSNRVFLCQDSKVTEIPPDLPRNAIELRFVLTKLRVIPKGSFSGFGDLEKIEI SQNDVLEVIEADVFSNLPNLHEIRIEKANNLLYINPEAFQNLPSLRYLLISNTGIKHLPA FHKIQSLQKVLLDIQDNINIHIIARNSFMGLSFESVILWLNKNGIQEIHNCAFNGTQLDE LNLSDNNNLEELPDDVFQGASGPVVLDISRTKVYSLPNHGLENLKKLRARSTYRLKKLPS LDKFVMLIEASLTYPSHCCAFANWRRQTSELHPICNKSISRQDIDDMTQPGDQRVSLVDD EPSYGKGSDMLYSEFDYDLCNEFVDVTCSPKPDAFNPCEDIMGYNILRVLIWFISILAIT GNTTVLVVLTTSQYKLTVPRFLMCNLAFADLCIGIYLLLIASVDIHTKSQYHNYAIDWQT GAGCDAAGFFTVFASELSVYTLAAITLERWHTITHAMQLECKVQLCHAASIMVLGWAFAF AAALFPIFGISSYMKVSICLPMDIDSPLSQLYVMALLVLNALAFVVICGCYTHIYLTVRN PNIVSSSRDTKIAKRMATLIFTDFLCMAPILFFAISASLKVPLITVSKAKILLVLFYPIN SCANPFLYAIFTKNFRRDFFVLMSKFGCYEVQAQIYKTETSSITHNFHSRKNPCSSAPRV TNSYVLVPLNHSVQN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

■ Q&A

We are interested in the following protein Recombinant Mouse Follicle-stimulating hormone receptor (Fshr) (CSB-CF009021MO). My understanding is that you have not expressed this protein. However, if you are able to express the protein we would purchase a small quantity first to test it out. We would also like bulk pricing for 4mg so we know how to budget. Can you please provide our bulk price for 4mg as reference?

Thanks for your inquiry.
Recombinant Mouse Follicle-stimulating hormone receptor(Fshr)
CSB-CF009021MO
Expression Region: 18-692aa; Full length of the mature protein.
Tag information:Tag type will be determined during the manufacturing process. (The expected tag is N-terminal 10xHis-tagged)
Sequence:

Statement:
As we checked that this full length protein nearly hasn't been expressed on the market, there is very a few reference information, and this protein itself is very large,
it has some difficulty to express, probably it will finally not being expressed, however, we can still try it as risk-free service, if it's finally failed, we will not charge any fees. You can decide by yourself whether to have a try or not considering the high risk.
Yes, we haven't expressed this protein before, and this protein expression exists some difficulty after our evaluation. We can still try it as risk-free service, if it's finally failed, we will not charge any fees.We recommend you to choose a small size to have try, since we haven't expressed, we don't know the yield, we can offer a price of 4mg for your reference.The 4mg protein will be provided in several batches. Probably we can consider to offer additional discount based on the yield if the protein is successfully expressed.

Target Background

Function(From Uniprot)

G protein-coupled receptor for follitropin, the follicle-stimulating hormone. Through cAMP production activates the downstream PI3K-AKT and ERK1/ERK2 signaling pathways.

Gene References into Functions

These data highlight an important interdependency between the potent pro-inflammatory cytokine IL1A and Fshr expression. PMID:28337831
Mouse chondrocytes and human articular cartilage express functional FSHR. Moreover, FSH can act on chondrocytes and cause genetic changes. PMID:29133260
Study demonstrates expression of follicle-stimulating hormone receptor (FSHR) and a direct action of follicle-stimulating hormone on testicular stem/germ cells possibly mediated via alternatively spliced growth factor type 1 receptor FSHR3 in mice. PMID:27189070
FSHR and LHR proteins are significantly upregulated in CCs surrounding oocytes arrested at the 2-cell stage, reflecting their developmental incompetence. PMID:24476692
Data (including date from knockout mice) suggest that Fshr is expressed early in pregnany in placenta and other extragonadal tissues of fetoplacental unit; expression is particularly strong at term. PMID:25100706
Sertoli cell-specific expression of MTA2 is required for transcriptional regulation of FSHR gene during spermatogenesis. PMID:23086931
The results demonstrate that gain-of-function mutations of the FSHR in mice bring about distinct and clear changes in ovarian function PMID:20172968
haploinsufficiency of the follicle-stimulating hormone receptor accelerates oocyte loss inducing early reproductive senescence and biological aging in mice PMID:12135868
show that FSH-R haploinsufficiency leads to a decrease in ovulation, altered ovarian steroidogenesis, and neuroendocrine impairments resulting in early reproductive senescence PMID:12135869
the loss of FSH-R signaling alters the follicular environment, where oocyte-granulosa interactions are perturbed, creating an out-of-phase germ cell and somatic cell development PMID:12801992
Chronic depletion of sex hormone E2 from early development leads to neural impairments in adult and aged FORKO mice that are associated with hypertrophy of glial cells, cell loss in distinct brain regions, and abnormal anxiety behavior PMID:14552897
These results suggest that FSH-R signaling normally maintains water balance in Sertoli cells in addition to regulating androgen-binding protein production. (FSH receptor) PMID:14998910
shrinkage in epididymal epithelial areas observed in follicle stimulating hormone receptor knockout mice PMID:15973687
loss of FSH-R signaling causes an imbalance of PDGF family members predisposing the abnormal ovarian follicular environment for inducing tumorigenesis in aging FORKO mice PMID:16344272
The complex cellular biology of follitropin receptors that may interact differently with polymorphic forms (glycosylation variants) of FSH represents an intricate scheme to regulate hormone signaling. PMID:17081682
These data suggest that FSH-R3 signaling promotes proliferation of ovarian cancer cells. PMID:17234334
FORKO mice developed age-dependent declines in bone mineral density and trabecular bone volume of the lumbar spine and femur, which could be partly reversed by ovarian transplantation. PMID:17332067
Gender-specific impairments in translocation of phosphorylated map erk kinases were found in the CNS structures in aged FSH-R knockout mice. PMID:17470386
FSHR gene expression is regulated distinctly in the osteoclast, and differently from other cells, such as the ovarian follicular and Leydig cells. PMID:17681281
Follitropin-receptor knockout (FORKO) females have an impaired natriuretic peptide system, which may contribute to the susceptibility of FORKO mice to developing age-related hypertension previously shown in these animals. PMID:18063689
USF1 and USF2 bind the Fshr promoter and revealed differences between Sertoli and granulosa cells in compensatory responses to USF loss and the USF dimeric composition required for Fshr transcription PMID:18566134