Recombinant Mouse Fatty acid desaturase 2 (Fads2)

Code: CSB-CF007960MO

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5817

Quantity:

Express system: in vitro E.coli expression system

Species: Mus musculus (Mouse)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Fads2

Uniprot NO.

Q9Z0R9

Species

Mus musculus (Mouse)

Source

in vitro E.coli expression system

Expression Region

1-444

Target Protein Sequence

MGKGGNQGEGSTERQAPMPTFRWEEIQKHNLRTDRWLVIDRKVYNVTKWSQRHPGGHRVI GHYSGEDATDAFRAFHLDLDFVGKFLKPLLIGELAPEEPSLDRGKSSQITEDFRALKKTA EDMNLFKTNHLFFFLLLSHIIVMESLAWFILSYFGTGWIPTLVTAFVLATSQAQAGWLQH DYGHLSVYKKSIWNHVVHKFVIGHLKGASANWWNHRHFQHHAKPNIFHKDPDIKSLHVFV LGEWQPLEYGKKKLKYLPYNHQHEYFFLIGPPLLIPMYFQYQIIMTMISRRDWVDLAWAI SYYMRFFYTYIPFYGILGALVFLNFIRFLESHWFVWVTQMNHLVMEIDLDHYRDWFSSQL AATCNVEQSFFNDWFSGHLNFQIEHHLFPTMPRHNLHKIAPLVKSLCAKHGIEYQEKPLL RALIDIVSSLKKSGELWLDAYLHK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Involved in the biosynthesis of highly unsaturated fatty acids (HUFA) from the essential polyunsaturated fatty acids (PUFA) linoleic acid (LA) (18:2n-6) and alpha-linolenic acid (ALA) (18:3n-3) precursors, acting as a fatty acyl-coenzyme A (CoA) desaturase that introduces a cis double bond at carbon 6 of the fatty acyl chain. Catalyzes the first and rate limiting step in this pathway which is the desaturation of LA (18:2n-6) and ALA (18:3n-3) into gamma-linoleate (GLA) (18:3n-6) and stearidonate (18:4n-3), respectively. Subsequently, in the biosynthetic pathway of HUFA n-3 series, it desaturates tetracosapentaenoate (24:5n-3) to tetracosahexaenoate (24:6n-3), which is then converted to docosahexaenoate (DHA)(22:6n-3), an important lipid for nervous system function. It can also desaturate (11E)-octadecenoate (trans-vaccenoate) at carbon 6 generating (6Z,11E)-octadecadienoate. In addition to Delta-6 activity, this enzyme exhibits Delta-8 activity with slight biases toward n-3 fatty acyl-CoA substrates.

Gene References into Functions

Data (including data from studies using knockout mice) suggest that increased dietary intake of EPA (eicosapentaenoic acid) and DHA (docosahexaenoic acid) differentially affects activity of D5D/Fads1 and D6D/Fads2 in specific tissues. PMID:28697636
In comparison, Fads2-/- and WT mice fed AD showed minimal differences in n-6 PUFA content in serum and WAT, despite having significantly more AA than CD-fed mice. No differences in gene expression for common inflammatory adipokines (e.g. Mcp-1, Ccl5, Tnfalpha) or key regulators of eicosanoid production (e.g. Cox-2, Alox-12, Alox-15) were detected in WAT between any of the diet and genotype groups PMID:29031400
In this study, an obvious hepatic lipid accumulation was observed in essential fatty acid deficiency (EFAD) mice treated with a FADS2 inhibitor. FADS2 inhibition in the EFAD state reduced secretion of very low-density lipoprotein (VLDL) and markedly diminished Mead acid in phosphatidylcholine (PC) in the liver and plasma. PMID:29353041
Data (including data from studies using knockout mice) suggest that immunomodulatory effects of dietary omega-6 vs. omega-3 fatty acids are due, in part, to interconversion of the various unsaturated fatty acids consumed/administered; thus, delta-6 desaturase plays role in immunomodulatory effects of dietary unsaturated fatty acids. PMID:27142734
Using a sample of 534 twins, study observed a trend in the moderation of brain fatty acid effects on IQ by FADS2 variation. Using of publicly available gene expression databases from both humans and mice, showed that FADS2 variants also correlate with FADS1 brain expression PMID:23826354
differential PUFA profiles between HET mice and human FADS SNPs suggest low expression of both FADS1 and 2 genes in human minor haplotypes. PMID:27613800
FADS2 deficient mice are obesity resistant. PMID:24378641
knockdown of Elovl5, Fads1, or Fads2 decreased the level of Mead acid. PMID:24184513
D6D activity is upregulated during melanoma and lung tumor growth and that suppressing D6D activity, either by RNAi knockdown or a specific D6D inhibitor, dramatically reduces tumor growth. PMID:23112819
Results suggest that Fads2 is essential for spermatogenesis; Fads2-/- knockout mice develop docosahexaenoic acid deficiency and acrosome biogenesis is halted after release of proacrosomal granules. PMID:21653892
analysis of macrophage cholesterol biosynthesis and decreased cellular paraoxonase 2 (PON2) expression in Delta6-desaturase knockout (6-DS KO) mice PMID:20042190
We created D6D-null mice (-/-), which enabled us to study highly unsaturated fatty acid deficiency without depleting their precursors. PMID:19351970
methylation silencing of liver Fads2 expression and changes in liver fatty acids may contribute to the pathology of hyperhomocysteinemia. PMID:17971455
Conjugated linoleic acid-induced fat loss was found to be dependent on delta6-desaturase activity. PMID:18719641
deletion of delta6-fatty acid desaturase (FADS2) gene expression abolishes the initial step in the enzymatic cascade of PUFA synthesis PMID:19172737

Hide All

Subcellular Location

Endoplasmic reticulum membrane; Multi-pass membrane protein.

Protein Families

Fatty acid desaturase type 1 family

Tissue Specificity

Highly expressed in the adrenal gland, liver, brain, and testis, tissues where lipogenesis and steroidogenesis are active. Also detected in lung, heart, and skeletal muscle.

Database Links

UNIGENE: Mm.38901

KEGG: mmu:56473

STRING: 10090.ENSMUSP00000025567

Promotions