MGKGGNQGEGSTERQAPMPTFRWEEIQKHNLRTDRWLVIDRKVYNVTKWSQRHPGGHRVI GHYSGEDATDAFRAFHLDLDFVGKFLKPLLIGELAPEEPSLDRGKSSQITEDFRALKKTA EDMNLFKTNHLFFFLLLSHIIVMESLAWFILSYFGTGWIPTLVTAFVLATSQAQAGWLQH DYGHLSVYKKSIWNHVVHKFVIGHLKGASANWWNHRHFQHHAKPNIFHKDPDIKSLHVFV LGEWQPLEYGKKKLKYLPYNHQHEYFFLIGPPLLIPMYFQYQIIMTMISRRDWVDLAWAI SYYMRFFYTYIPFYGILGALVFLNFIRFLESHWFVWVTQMNHLVMEIDLDHYRDWFSSQL AATCNVEQSFFNDWFSGHLNFQIEHHLFPTMPRHNLHKIAPLVKSLCAKHGIEYQEKPLL RALIDIVSSLKKSGELWLDAYLHK
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Involved in the biosynthesis of highly unsaturated fatty acids (HUFA) from the essential polyunsaturated fatty acids (PUFA) linoleic acid (LA) (18:2n-6) and alpha-linolenic acid (ALA) (18:3n-3) precursors, acting as a fatty acyl-coenzyme A (CoA) desaturase that introduces a cis double bond at carbon 6 of the fatty acyl chain. Catalyzes the first and rate limiting step in this pathway which is the desaturation of LA (18:2n-6) and ALA (18:3n-3) into gamma-linoleate (GLA) (18:3n-6) and stearidonate (18:4n-3), respectively. Subsequently, in the biosynthetic pathway of HUFA n-3 series, it desaturates tetracosapentaenoate (24:5n-3) to tetracosahexaenoate (24:6n-3), which is then converted to docosahexaenoate (DHA)(22:6n-3), an important lipid for nervous system function. It can also desaturate (11E)-octadecenoate (trans-vaccenoate) at carbon 6 generating (6Z,11E)-octadecadienoate. In addition to Delta-6 activity, this enzyme exhibits Delta-8 activity with slight biases toward n-3 fatty acyl-CoA substrates.
Gene References into Functions
Data (including data from studies using knockout mice) suggest that increased dietary intake of EPA (eicosapentaenoic acid) and DHA (docosahexaenoic acid) differentially affects activity of D5D/Fads1 and D6D/Fads2 in specific tissues.PMID:28697636
In comparison, Fads2-/- and WT mice fed AD showed minimal differences in n-6 PUFA content in serum and WAT, despite having significantly more AA than CD-fed mice. No differences in gene expression for common inflammatory adipokines (e.g. Mcp-1, Ccl5, Tnfalpha) or key regulators of eicosanoid production (e.g. Cox-2, Alox-12, Alox-15) were detected in WAT between any of the diet and genotype groupsPMID:29031400
In this study, an obvious hepatic lipid accumulation was observed in essential fatty acid deficiency (EFAD) mice treated with a FADS2 inhibitor. FADS2 inhibition in the EFAD state reduced secretion of very low-density lipoprotein (VLDL) and markedly diminished Mead acid in phosphatidylcholine (PC) in the liver and plasma.PMID:29353041
Data (including data from studies using knockout mice) suggest that immunomodulatory effects of dietary omega-6 vs. omega-3 fatty acids are due, in part, to interconversion of the various unsaturated fatty acids consumed/administered; thus, delta-6 desaturase plays role in immunomodulatory effects of dietary unsaturated fatty acids.PMID:27142734
Using a sample of 534 twins, study observed a trend in the moderation of brain fatty acid effects on IQ by FADS2 variation. Using of publicly available gene expression databases from both humans and mice, showed that FADS2 variants also correlate with FADS1 brain expressionPMID:23826354
differential PUFA profiles between HET mice and human FADS SNPs suggest low expression of both FADS1 and 2 genes in human minor haplotypes.PMID:27613800
FADS2 deficient mice are obesity resistant.PMID:24378641
knockdown of Elovl5, Fads1, or Fads2 decreased the level of Mead acid.PMID:24184513
D6D activity is upregulated during melanoma and lung tumor growth and that suppressing D6D activity, either by RNAi knockdown or a specific D6D inhibitor, dramatically reduces tumor growth.PMID:23112819
Results suggest that Fads2 is essential for spermatogenesis; Fads2-/- knockout mice develop docosahexaenoic acid deficiency and acrosome biogenesis is halted after release of proacrosomal granules.PMID:21653892
analysis of macrophage cholesterol biosynthesis and decreased cellular paraoxonase 2 (PON2) expression in Delta6-desaturase knockout (6-DS KO) micePMID:20042190
We created D6D-null mice (-/-), which enabled us to study highly unsaturated fatty acid deficiency without depleting their precursors.PMID:19351970
methylation silencing of liver Fads2 expression and changes in liver fatty acids may contribute to the pathology of hyperhomocysteinemia.PMID:17971455
Conjugated linoleic acid-induced fat loss was found to be dependent on delta6-desaturase activity.PMID:18719641
deletion of delta6-fatty acid desaturase (FADS2) gene expression abolishes the initial step in the enzymatic cascade of PUFA synthesisPMID:19172737
Highly expressed in the adrenal gland, liver, brain, and testis, tissues where lipogenesis and steroidogenesis are active. Also detected in lung, heart, and skeletal muscle.