Ednra; Gpcr10; Endothelin-1 receptor; Endothelin receptor type A; ET-A; ET-AR
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
21-427
Target Protein Sequence
DNPERYSANLSSHMEDFTPFPGTEINFLGTTHRPPNLALPSNGSMHGYCPQQTKITTAFK YINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFK LLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPL ITAIEIVSIWILSFILAIPEAIGFVMVPFEYKGELHRTCMLNATSKFMEFYQDVKDWWLF GFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWF PLHLSRILKKTVYDEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCF QSCLCCCCHQSKSLMTSVPMNGTSIQWKNQEQNNHNTERSSHKDSMN
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Receptor for endothelin-1. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of binding affinities for ET-A is: ET1 > ET2 >> ET3.
Gene References into Functions
ET-1 injection into the TG promotes ETAR/ETBR-mediated facial heat hyperalgesia, and both receptors are clearly implicated in Constriction of Iinfraorbital Nerve-induced hyperalgesia in the murine Trigeminal system.PMID:29570803
Mutant Ednra (Y129F) mice represent a valuable viable model for complex human syndromes of the first and second pharyngeal arches and for further studies and analysis of impaired endothelin 1 (EDN1)-endothelin receptor type A (EDNRA) signaling. Above all, Ednra (Y129F) mice model the recently published human MFDA syndrome and may be helpful for further disease understanding and development of therapeutic interventionsPMID:27671791
endothelin A receptor activation on mesangial cells is a key event in initiation of Alport glomerular disease in this mouse model.PMID:27165837
Atrasentan treatment was effective in reducing the severity of colitis in DSS- and TNBS-treated mice, suggesting that ETA receptors might be a potential target for inflammatory bowel diseasesPMID:27778057
Endothelin A receptor may be involved in paraquat-induced toxic myocardial contractile anomalies possibly related to apoptosis and mitochondrial damage.PMID:26089164
ETAR-positive macrophages highly accumulated in the inflamed liver of mutant p53(R172) plus IL27RA(-/-)PMID:26637970
The cardiac expression of prepro-endothelin-1 mRNA, endothelin-converting enzyme-1 mRNA, and protein and endothelin receptors A and B mRNA was increased in 18-week-old obese C57BL/6 mice compared to animals with normal weightPMID:25181417
Venous Edn1 guides stellate ganglia axons to innervate the developing heart via Ednra on those axons. Edn1-Ednra signalling is essential for functional regulation of the heart by sympathetic nerves.PMID:24875861
Smooth muscle ETA is important for normal vascular, mandibular and thymic development and is involved in the maintenance of arterial pressure under physiological conditions.PMID:24412386
Mice lacking ETA only in sympathetic neurons (SN-KO) showed less adverse structural remodeling and cardiac dysfunction in response to pathological pressure overload induced by transverse aortic constriction.PMID:25197047
Endothelin receptors A and B regulate early pathogenesis of spinal cord injury and determine the outcomes of longterm neurological recovery.PMID:24756152
ednra expression within the heart was restricted to the myocardiumPMID:25050930
Podocyte endothelin type A receptors significantly contribute to diabetes-induced activation of the beta-catenin cascade.PMID:24722437
Data from studies using various receptor antagonists/agonists suggest that endothelin-A receptors (Ednra), alpha2-adrenoceptors, and imidazoline receptors are involved in body temperature regulation in mice.PMID:22681550
Progesterone regulates Ednra expression by synergizing with Gata2 activity.PMID:23592430
Endothelin 1 (ET-1) evokes pruritic and nociceptive behaviors in the mouse cheek model; both responses to ET-1 appear to be mediated via ETA receptorsPMID:22483687
Knockout of ET(A) receptor protects against cold temperature-induced cardiac hypertrophy and contractile dysfunction.PMID:22442497
ET(A) receptor expression in vascular advential fibroblasts mediates collagen I expression.PMID:21949113
These results indicate that Ednra expression may be linked with non-epithelial fate determination and differentiation of metanephric mesenchyme.PMID:21565284
Enhaces IgE dependent anaphylaxis in mice.PMID:21555149
ETA receptor immunoreactivity was no longer observed in the vessels but became localized to the myelinating oligodendrocytes of the primitive corpus callosum of the white matter, apart from the vessels.PMID:21218036
ETA receptors play an important role in maintaining homeostasis between ET-1- mediated contraction and basal NO dilatory tone in cerebral blood vessels. ETB receptors play a detrimental role in increased TGF-beta1 induced vascular dysfunction.PMID:20628431
Selective ETAR antagonism by ZD4054 displays antitumoral activity on breast cancer cells in vitro and in vivo. Data strongly support a rationale for the clinical use of ZD4054 in combination with endocrine therapies.PMID:19943105
Study identifies in the mouse a subpopulation of the first (crescent-forming) field marked by endothelin receptor type A (Ednra) gene expression, which contributes to chamber myocardium through a unique type of cell behavior.PMID:20929948
Renin-angiotensin-aldosterone system components are upregulated under endothelin blockade.PMID:20093323
A paracrine vasoregulatory pathway mediated by endothelial cell-derived ET-1 acting on the vascular smooth muscle ET(A) receptor.PMID:20516397
Data revealed localization of both endothelin receptors A and B to the columnar epithelial cells within the oviduct, suggestive of a local role for endothelins in the regulation of epithelial function and ultimately oviductal secretions.PMID:20357223
The present study elucidates the role of ETA receptors expressed in sensory nerves and thereby helps to understand the precise mechanisms via which the ET1-ETA axis contributes to the pathogenesis of complex pain disorders.PMID:19879049
Increased gene expression and production of endothelin receptors after birth.PMID:12763050
in adult mice cardiac ET(A) receptors are not necessary for either baseline cardiac function or stress-induced response to angiotensin II or isoproterenolPMID:14585980
establishment of a 'mandibular identity' during lower jaw development requires both Ednra-dependent and -independent signaling pathwaysPMID:15306564
Ednra receptor signaling is crucial for early neural crest cell patterning,but subsequent Ednra signaling is not essential for mandible bone development.PMID:15647918
ETA receptor blockade increased ETB receptor gene expression in prediabetic NOD mice.PMID:15838254
Deletion of the Ednrb is associated with a reduction in both central and peripheral Ednra density.PMID:15838300
Report real-time polymerase chain reaction quantification of gene expression levels of murine endothelin-A and endothelin-B receptors: gene expression profiles by the standard curve method.PMID:15838311
Demonstrate endothelin receptors are highly expressed in mouse heart and brain.PMID:15838332
ET receptors in pigment cells of vertebrate species were identified by RT-PCR assays, and the differential expression of the various subtypes in each species was compared by quantitative PCR.PMID:16962346
Endothelin receptor A has a role in progression of prostate cancerPMID:16984730
Cranial neural crest cells require Ednra signaling with loss of Ednra signaling leading to premature cessation of migration into or within the arches and subsequent cell death.PMID:17294360
The results suggest that an endothelin-mediated response via two different receptors, ETAR and ETBR, may play an important role in the physiological functions of the cochlear lateral wall by maintaining the homeostatic environment of the cochlea.PMID:17607529
endothelin A receptor and epidermal growth factor receptor are targeted by the combination of ZD4054 and gefitinib in ovarian carcinomaPMID:17616694
Both (11)C-BMS-5p 3 and (18)F-FBzBMS 5 bind selectively to the ETA receptor in vivo. Further development of these radioligands for imaging the ETA receptor in humans is warranted.PMID:18703610
Collecting ducct endothelin B and type A receptors exert a combined hypotensive effect that exceeds that of either receptor alone.PMID:18784261
Elucidating timing and function of Ednra signaling during craniofacial development using neural crest cell-specific gene deletion and receptor antagonism are reported.PMID:19185569
Bosentan enhances viral load via endothelin-1 receptor type-A-mediated p38 mitogen-activated protein kinase activation while improving cardiac function during coxsackievirus-induced myocarditis.PMID:19213955
Chronic administration of Ednra/b antagonists during the induction of fibrosis and portal hypertension led to reduced fibrosis, a significant reduction in portal pressure, and altered sinusoidal dynamics.PMID:19299580